KEGG   Clostridium botulinum A Hall: CLC_1692Help
Entry
CLC_1692          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C92
Motif
Other DBs
NCBI-GeneID: 5401144
NCBI-ProteinID: YP_001387548
UniProt: A5I2D6
Position
complement(1783823..1784374)
Genome map
AA seq 183 aa AA seqDB search
MEKYKQIYIVLSLTGSNFGHLIKFYTKEPYSHVSLAFDKELNEMYSFGRKYPNNPFIAGF
VKESLDKGAFLKFKNAECTIYSLDITEDKYYKLKEIIENFKEESDKYSYNLLGILGVIIG
YPLETKYKYFCSQFVSHVLIKSGVQLFNKPPGLTTPQDFRIYENKRIIYSGKLNEYSNYN
YTI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatataaacaaatatatatagtcctatcattaacaggttcaaattttggacac
cttataaaattttatacaaaggaaccctactcccatgtatccttagcctttgataaggaa
ttaaatgaaatgtatagttttggtagaaaatatcctaataaccccttcatagcaggattt
gttaaagaatctttggacaagggtgcatttcttaaatttaaaaatgctgaatgtaccata
tattccctagatattacagaagataaatattataagctaaaagaaataattgaaaatttt
aaagaagaaagtgataaatatagctataatcttttaggtatattgggagtaataattggt
tacccattagaaacaaaatataaatatttttgttctcaatttgtttcccatgtacttatt
aaatccggtgtgcaattgtttaataaacctcctggtcttacaactcctcaggattttaga
atttatgaaaataaaaggattatatatagtggtaaacttaatgaatatagtaattataat
tatactatttag

DBGET integrated database retrieval system