KEGG   Clostridium botulinum A Hall: CLC_1701Help
Entry
CLC_1701          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1002 Latarcin COMMD1_N Frankia_peptide Nop PRD
Motif
Other DBs
NCBI-GeneID: 5401138
NCBI-ProteinID: YP_001387557
UniProt: A5I2N0
Position
1795810..1796760
Genome map
AA seq 316 aa AA seqDB search
MKCKTVISKLLVLVFTFSLIISASSANKVYADAFKVVTLGADLTNEQKEEMLKYFGVTRK
EANVMEVNKEEEDKYLAGVATRKQIGTKSISCAYVEPTDKGGLNISTHNIYWVTENMIRN
ALITAGVENANVKVGAPFNVSGTAALTGILKGFESSKGGKKIDEEKKKVANEEMVVTGNL
GEKIGQDEAANLINEVKKEVVKEKPKTEKEIKNIVKDATNNYGYKLSDEDMQKITALMDK
INGLDLDFKQIKDQLNQVSNKLKDVVTSEEAKGFFSKLWEGIKDFFDNIFSSNKEEKTTS
YNVTKVQNITYNKLRI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcaaaacagtgattagtaaattattagttttagtgtttactttttctttaata
atatctgcttcttcagccaataaagtttatgcagatgcttttaaagtggttacgttaggg
gcagatttaactaatgaacaaaaggaagaaatgcttaaatattttggagtaacaagaaaa
gaagctaatgtaatggaagttaacaaagaagaagaagataagtatttagctggagtggct
acaagaaaacaaataggaacaaaatctatatcctgtgcctatgtagaacctacagataag
ggtgggctaaacatatctactcataatatatattgggttacggaaaatatgattagaaat
gctttaataactgcaggagtagaaaatgctaatgtcaaagtaggagcaccttttaatgta
tctggtacagcagctcttacaggtatattaaaaggttttgaaagtagcaaaggcgggaaa
aaaatagatgaagagaagaagaaagttgctaatgaagagatggttgttactggtaattta
ggagaaaaaataggacaagatgaagcagctaacttaataaatgaagttaaaaaagaggtt
gttaaggaaaaaccaaaaacagaaaaagaaataaaaaacatagtaaaagatgcaactaat
aattatggttataaattaagtgatgaagatatgcaaaagataacagctctaatggataag
ataaatggattggatttagactttaagcaaataaaagaccagttaaatcaggttagtaat
aaattaaaagatgttgtaactagcgaagaggcaaaaggcttctttagtaagctatgggaa
ggtattaaagatttctttgataatatttttagtagcaataaagaagaaaaaactacatct
tacaatgtaacgaaagttcaaaatataacttataataagttgagaatataa

DBGET integrated database retrieval system