KEGG   Clostridium botulinum A Hall: CLC_1702Help
Entry
CLC_1702          CDS       T00575                                 

Definition
(RefSeq) UbiE/COQ5 family methlytransferase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1797032..1797667
Genome map
AA seq 211 aa AA seqDB search
MKNLMNKVYGQFRRPKGMIGKFIAKSMNKEHFKVTTWGLHKLKVKDSNIILDIGCGGGRT
VNRLAHGVPKGKVFGMDYSLDCVNFSKKYNKDLIENGKVEIIHGSVDKMPFEDDKFDIIS
AVETTYFWPNLLDSFKEVKRVLKPSGKFIIVNASYTNEKFKERNEEYLRKVPGMKIYSVD
YIKNLLEEVGYKNISIETLEEENWLCAIGEK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaatgaataaagtttatggacaatttagaaggcctaaaggaatgataggt
aaatttattgcaaaaagtatgaataaagaacactttaaagtaactacttggggacttcat
aaacttaaagtaaaagatagtaatatcatattagacataggctgtggaggaggaaggact
gtaaacagacttgctcatggagttccaaaaggaaaggtttttggcatggattattcttta
gattgtgtgaatttttctaaaaaatataacaaagatttaatagaaaatggcaaagtagag
attattcatggtagtgtagataaaatgccctttgaagatgataaatttgatattatatct
gcagtagaaactacatatttttggccaaatttattagacagttttaaggaagtaaaaaga
gtactaaaaccttcaggaaagtttattatagtaaatgctagttatactaatgaaaaattt
aaagaaagaaatgaagaatatctaagaaaagtaccaggtatgaaaatatatagtgtggat
tatataaaaaacttattagaagaagtgggatataagaatatatccatagagaccttagaa
gaggaaaattggctatgtgccataggagaaaaatag

DBGET integrated database retrieval system