KEGG   Clostridium botulinum A Hall: CLC_1705Help
Entry
CLC_1705          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1799941..1800504
Genome map
AA seq 187 aa AA seqDB search
MKQKILDITSKNIELYGLKKFTMDDISYDLKISKKTIYKYFKSKNDLISQYFNEIIDSDK
KSTLELLEKKMPLDEKLYNIIYSYHKYKLSVRILDEAYKFYPEEFKKIQEFKDFKIDLVK
KILREGKNQGVIEENININIVSLILEKVSDTFLDYKFLTNNNITMKQAMVDLMNILLNGI
LNENYNG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaatattagatataacctctaaaaatatagaattatatgggttgaaaaaa
tttaccatggatgatatatcctatgatcttaaaataagtaaaaaaaccatatacaagtat
tttaaaagtaagaatgatctaataagccaatattttaatgaaataatagacagtgataaa
aaaagcactttagaattattagaaaagaaaatgcctttagacgaaaaattatataatata
atctattcttatcataaatataaattatcagtaaggattttggatgaagcttataaattc
tatcctgaggaatttaaaaaaattcaagagtttaaagattttaaaatagatttagtaaaa
aaaattttaagagaaggtaaaaatcaaggggtaatagaagaaaatataaatataaatata
gtaagtttaattttagaaaaagttagtgatacatttttagactataaatttttaactaat
aataatattactatgaaacaagccatggtagatttgatgaatatactattaaatggtatt
ttaaatgaaaattataatgggtaa

DBGET integrated database retrieval system