KEGG   Clostridium botulinum A Hall: CLC_1708Help
Entry
CLC_1708          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1803700..1803855
Genome map
AA seq 51 aa AA seqDB search
MKTKKNKIRGNKEQLNSLDLKNNPEINSNYYGDDDNISTQIVTNYYYTPDK
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactaaaaaaaataaaataagaggtaataaagagcagttgaatagtttggattta
aagaacaatccggaaataaattcaaattattatggtgatgatgataatatatctactcaa
atagttacaaattattattatactccagataagtaa

DBGET integrated database retrieval system