KEGG   Clostridium botulinum A Hall: CLC_1719Help
Entry
CLC_1719          CDS       T00575                                 

Definition
(RefSeq) sulfite/nitrite reductase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1814804..1815658
Genome map
AA seq 284 aa AA seqDB search
MKMISKNEIAKLKGEGFLAQKQEGYFSVRILSRAGNFTSKQIIKLAEIADNYGKGYLGVT
TRLATEIPWIRYEDIEAVKKEIVSSGMSHGGTGKRVRPLVSCKGTVCVHGLYDTQKLCGE
LHDKYFGYELPSKFKITLVGCPNNCAKASINDIGIMGQAYVEFDEEKCKVCGICTKSCRQ
KAVTVENKKIVYKKDLCVNCGKCATVCPFEAMTIKEQGLQVYLGGRFGREYRMGNRLKGL
YKEEEIPALVQKIFDVYSEMGNPGERLAKMIERVGFDKVEEAIL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgataagtaaaaatgaaattgcaaagcttaaaggtgaaggatttttagctcaa
aaacaagaaggatatttttctgtaagaatattaagtagagcagggaattttacttctaag
cagattataaaattggcagaaatagcagataattatggaaaaggctatttaggggtaact
acaagattagctacagaaattccttggattagatacgaagatatagaagcagtaaaaaaa
gaaatagtatctagtggtatgagtcatggaggtacaggtaaaagagtgagacctttagta
tcctgtaagggtactgtttgtgtccatggactatatgatacacaaaaactttgcggtgag
cttcatgataaatactttggctatgaattaccgtcaaagtttaaaataactctagtagga
tgtcctaataactgtgctaaggcatctattaatgatataggaattatgggacaggcatat
gtggaattcgatgaagaaaaatgtaaagtttgcggtatatgtactaaatcctgtaggcaa
aaggctgttactgtagaaaataaaaaaatagtatataaaaaggatttatgtgtaaattgc
ggaaaatgtgctactgtttgtccttttgaagctatgaccattaaagagcaaggattacag
gtgtatttaggtggaagatttggaagagaatatagaatgggtaataggttaaaagggtta
tacaaggaagaggaaataccagctttagtacaaaagatttttgatgtatatagtgaaatg
ggaaatcccggcgaaagattagctaaaatgatagaaagagtaggctttgataaggtggaa
gaagccatattataa

DBGET integrated database retrieval system