KEGG   Clostridium botulinum A Hall: CLC_1719Help
Entry
CLC_1719          CDS       T00575                                 

Definition
(RefSeq) sulfite/nitrite reductase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIR_SIR NIR_SIR_ferr Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_7 Fer4_16 Fer4_9 Fer4_15 Fer4_4
Motif
Other DBs
NCBI-GeneID: 5401210
NCBI-ProteinID: YP_001387575
UniProt: A5I2P8
Position
1814804..1815658
Genome map
AA seq 284 aa AA seqDB search
MKMISKNEIAKLKGEGFLAQKQEGYFSVRILSRAGNFTSKQIIKLAEIADNYGKGYLGVT
TRLATEIPWIRYEDIEAVKKEIVSSGMSHGGTGKRVRPLVSCKGTVCVHGLYDTQKLCGE
LHDKYFGYELPSKFKITLVGCPNNCAKASINDIGIMGQAYVEFDEEKCKVCGICTKSCRQ
KAVTVENKKIVYKKDLCVNCGKCATVCPFEAMTIKEQGLQVYLGGRFGREYRMGNRLKGL
YKEEEIPALVQKIFDVYSEMGNPGERLAKMIERVGFDKVEEAIL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgataagtaaaaatgaaattgcaaagcttaaaggtgaaggatttttagctcaa
aaacaagaaggatatttttctgtaagaatattaagtagagcagggaattttacttctaag
cagattataaaattggcagaaatagcagataattatggaaaaggctatttaggggtaact
acaagattagctacagaaattccttggattagatacgaagatatagaagcagtaaaaaaa
gaaatagtatctagtggtatgagtcatggaggtacaggtaaaagagtgagacctttagta
tcctgtaagggtactgtttgtgtccatggactatatgatacacaaaaactttgcggtgag
cttcatgataaatactttggctatgaattaccgtcaaagtttaaaataactctagtagga
tgtcctaataactgtgctaaggcatctattaatgatataggaattatgggacaggcatat
gtggaattcgatgaagaaaaatgtaaagtttgcggtatatgtactaaatcctgtaggcaa
aaggctgttactgtagaaaataaaaaaatagtatataaaaaggatttatgtgtaaattgc
ggaaaatgtgctactgtttgtccttttgaagctatgaccattaaagagcaaggattacag
gtgtatttaggtggaagatttggaagagaatatagaatgggtaataggttaaaagggtta
tacaaggaagaggaaataccagctttagtacaaaagatttttgatgtatatagtgaaatg
ggaaatcccggcgaaagattagctaaaatgatagaaagagtaggctttgataaggtggaa
gaagccatattataa

DBGET integrated database retrieval system