KEGG   Clostridium botulinum A Hall: CLC_1720Help
Entry
CLC_1720          CDS       T00575                                 

Gene name
cheV
Definition
(RefSeq) chemotaxis protein CheV
  KO
K03415  
two-component system, chemotaxis family, chemotaxis protein CheV
Organism
cbh  Clostridium botulinum A Hall
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLC_1720 (cheV)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CLC_1720 (cheV)
Two-component system [BR:cbh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CLC_1720 (cheV)
Bacterial motility proteins [BR:cbh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CLC_1720 (cheV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1815798..1816691)
Genome map
AA seq 297 aa AA seqDB search
METNILLESGTGEVEIIEFLVNNKHYAINVIKVKEVIEVDNVTKVPQSDPAIEGLILCRE
KIFPLIDLSYILGQKNTSKKKFKTIICEFNRVSVAFKIDEIVAVHRIGWDKILKPDDIAA
NPLVIGNILLKDKIILLLDFEKIVTDINPSTGISEERIVNVDYKDRSHIKVFLADDSSLI
RKLLKDTLTKAGFKKLTIFDDGKQVLDKLLELVEKKGEDFTEDVQILITDIEMPQMDGHT
LTRKVKEHPILKRLPVIIFSSLITKDLKHKGTSVGADEQLSKPDIGELVNIIDNYIE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggagactaatatattattagaatctggtacaggagaagtagaaataatagaattttta
gttaataataaacactatgctattaatgttataaaagtaaaagaagtaatagaagtagat
aatgtaactaaggtacctcaaagtgatccagctatagaaggattaattctatgtagggaa
aagattttcccactaatagacctttcttatatattgggtcaaaagaatacttcaaagaaa
aaatttaaaactatcatatgtgaattcaatagagttagtgtagcttttaaaatagatgaa
atagtagctgttcatagaataggttgggacaaaatattgaaaccagatgacatagctgct
aacccattggtcatagggaacatattattaaaagataaaattatattattactagatttt
gaaaaaatagttacagatataaatccgagtacaggtattagtgaagaaagaatagttaat
gtggattacaaagataggtctcatattaaggtattcttagctgatgattcttccttaata
agaaagcttttaaaagacacccttactaaagctggatttaaaaagctaaccatatttgac
gatggaaagcaagttttagacaagctacttgaactagtagaaaaaaagggtgaagatttc
acagaggatgtacaaattcttattacagatatagaaatgccccaaatggatggccatact
cttacaagaaaagttaaagaacacccaatacttaaaagacttcctgttataatattttcc
tctttaattacaaaggatttaaaacataaaggaacctctgtaggagcggatgaacaatta
agcaaaccagatataggggaattagtaaatataatagataattatatagaataa

DBGET integrated database retrieval system