KEGG   Clostridium botulinum A Hall: CLC_1722Help
Entry
CLC_1722          CDS       T00575                                 

Definition
(RefSeq) RNA-binding protein
  KO
K00243  
uncharacterized protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1818648..1819484
Genome map
AA seq 278 aa AA seqDB search
MIKLGEIQKLEIIREAPMGVYLNSKEDKSENDILLPGKQVPKDAKIGDEVEVFVYRDSED
RMIATINRPKITIGEIATLKVIEKTKMGAFLDWGLERDLFLPFKEQTYGIQEGMECLVYL
YIDKSDRLCASMNVYRVLSTESPYKEDDEVKGFIYDIKREIGAFVAVDNEYHGLIPKNEL
YGKFRYGDIVEARVTKVKEDGKLDLSIRKKAYKQMDEDVDTILEKLNSNGGKLYLNDNSD
PRAIKELLNMSKNAFKRAVGRLLKEGKIEFIEKGIKLK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgataaagttaggtgaaatacaaaagttagaaataataagagaggctcctatgggagta
tatttaaattctaaagaggataaaagtgaaaatgatatattattacctggaaaacaagtg
cctaaagatgctaaaataggtgatgaagtagaagtctttgtttatagggattcagaagat
aggatgatagctaccataaataggcctaaaataactattggggaaatagctactttaaag
gttatagaaaaaactaaaatgggagcttttctagactggggactagaaagagatttattt
ttaccatttaaagaacaaacttacggtatacaggaaggaatggaatgtttagtttattta
tacatagacaaaagcgatagactatgtgctagtatgaatgtatatagagtattaagtaca
gaatccccttataaagaggatgatgaagttaaagggtttatatatgatataaaaagagaa
ataggagcttttgttgctgtagacaatgaataccatggattaatacctaaaaatgaatta
tatggaaagtttagatatggagatatagtggaggctagagtaactaaagtaaaggaagat
ggtaaactagatttaagtattagaaaaaaagcatacaaacaaatggatgaggatgtagat
actattttagaaaagctaaattctaatggcggtaagctttatttaaatgataatagtgat
ccaagagctataaaggaacttttaaatatgagtaaaaatgcatttaaaagagcagtagga
agacttttaaaagaaggtaaaatagaatttattgaaaagggcattaagcttaaataa

DBGET integrated database retrieval system