KEGG   Clostridium botulinum A Hall: CLC_1724Help
Entry
CLC_1724          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5050 Big_4
Motif
Other DBs
NCBI-GeneID: 5401744
NCBI-ProteinID: YP_001387580
UniProt: A5I2Q3
Position
1821262..1825719
Genome map
AA seq 1485 aa AA seqDB search
MIRGVFAIFSKKFVAKFLLYSSIVIIPMFNHNYVQAASSKQYETKYNVSLDKVWKIRFSR
EVDKATLNPENIKILDNQGKEMPIDLSLDVDKHYVKIALKSGTYNGVHYSGKYEKDKKYS
LIVKEGLMSEPSKNKKSKNLAYETMMDFNTIGDNEYPGLPIEDGLIVIGDKAYSVGYLSK
HSSIANEITSNGNYYIAYISKEYGEKIKQVLGNNTTKGNQERANKILYYAPNGNQYEYEW
NEAFGEYKIVLPKAYVDVTPGVINGVVNLAVKQVKAVPGAKYFKLAHSNTIKPIGESISY
SMTYPTEKLTILSADETPLATALVDVYLPKTGYVSLSSVNETLGNTAGNISNNGSAAMDL
DFYVYYVNSADKNSLYRKTLTGRMDTQISLDKAQYINVIGDWIYYSNYNDNGKIYKMKKD
GTKKQILCDDTATYITVSGGVVYYANQSDKGRLYKINTDGTIDGGASNRDPAGKVHGMPV
MDDYGNYNKATDQANFINVVGDWIYYSNFSDGHKIYTVNKDGNIRRKVNDEWADGIQIVG
AWAYYCSGSGAISKVRVDGTGSVIPLRGTTRKVDKGYHLNIVDGWLYYSNAEDGGKLYRI
KEDGSGEKKKLADLATDYINIVGDTMYLISGGKTYTLPLNTDGTIKPTLVTKDNNGNTVV
DVKDLNITVAYEDANKTIGELEAKYLPQKVAVFMKDDTVQQLPVDWDIKNRKYNGQGIYT
YTGTVLGHGKQIKCTLTIPSEMLNATSIIEVYNNGPKNGSIMIKERSFGPSKQDQELKEK
LKLAKRVEIGDVIKVYDNPNSEKPLGNIKVDANNANGPLVKSLDLDMYGRSFWITITRKN
KAESKPTEVRQLGAAVLSGDVLDEDGEALGVDGRDFTVKGWNNPSIRDDGFISDTTEIAA
QGTKSIYVIPGTGKLNMENQGVIPAGITSANYWNGGNARALLTNYDLLTNDSLKNKLKEG
NYSIYVVVGYDGKAEEDVNGFGSPLVIGKTASIPKAMKATEEKIPKAPSVTKQYAKSGDT
VKISGVTNEDEIYLAPEGASYIAKDITNKPYKSHDNLFFEDQSKSKEEREKEYEKSGKPS
IEDGYQCKLVNGKIPQGVRSGKYKVYMVNAIGSSSPASGEIIVDNEDPVVRLDSAKQEDV
IKTVTQNGTTTQETTGQKFKVNFAAFDNSFDNSIKEGITVSMARLDSPKSAIKAQEIKDK
GNKTFEVIINDPHANLNDYAIYAEDKAGNIGQVNLKVQDPPANINNISLAIRTSNEGVDL
VKSRLVGRTKYMTKDLTRASDNYEVTVDGVKYVLQEEALRNLGTSPSIDAFMNALMQAKQ
WDIANNKPMEDKPKLSSKVSIYKVNDVIYIEGNDNTPIQIEDKTKIDSDTAIVSNMIGLN
PNENNTGENSKNQQYVINVTGTAQKNGKLKVCLAGKCFDINMVAGDSRTNIAAKIKEAIN
NNTILDSYQYPGTNVESNGSEVRLTRKSPGAVVPTFTVEYFNYDN
NT seq 4458 nt NT seq  +upstreamnt  +downstreamnt
ttgataaggggggtgtttgctatatttagtaaaaaatttgtagcaaagtttttattgtat
tcttctatagtgattataccaatgtttaaccacaattatgtacaagcagcttcatctaag
cagtatgaaacaaaatataatgtttcattggataaagtgtggaaaattagattttcaaga
gaagtagataaggctacattaaatccagaaaatataaagatactagataatcagggtaaa
gaaatgcctatagatctatctttagatgtagataagcattatgtaaaaattgctcttaaa
agtggaacttataatggagtacattattcaggaaaatatgaaaaagataaaaaatatagc
ttgattgtaaaggaaggccttatgagtgagccttctaaaaataaaaaatctaagaatctt
gcttatgaaacaatgatggactttaatactataggagataatgaatatcctggtcttcct
atagaggatggtttaatagtaataggagataaggcttattctgtagggtatctttctaag
cattcttctatagcaaatgaaataacttctaatgggaattattacatagcttatataagc
aaagaatatggagaaaagataaaacaagtattaggtaataatactactaaaggtaatcag
gaaagagcaaataaaatattatattatgcaccaaatggaaatcaatatgaatatgagtgg
aatgaggcttttggtgaatataaaatagttcttccaaaggcctatgtagacgtaactcca
ggagttataaatggagtggttaatttagctgtaaagcaggtaaaggcagtaccaggagca
aaatattttaaattagctcatagtaataccattaaacctataggagaatcaatttcttat
tctatgacctatccaacagaaaaattaactatattatccgcagatgaaacacctttagct
acagctttagtggatgtatatttacctaaaaccggttatgttagtttaagtagtgtaaat
gaaaccttaggaaatacagcaggtaatataagtaataatggtagtgctgctatggactta
gatttttatgtttactatgtaaattctgcagataaaaattctttatatagaaagacttta
acaggaagaatggatactcaaataagtcttgataaggctcaatatattaatgtaataggt
gattggatatattacagtaattataacgataatgggaaaatatataagatgaaaaaggat
ggtactaaaaagcaaatattatgtgatgatactgcaacttatataactgtatccggtgga
gttgtatattacgcaaatcaatcagataaaggaagactgtataaaataaatacagacggt
accatagatggcggagcttccaatagagaccctgcaggaaaggttcatggtatgccagta
atggatgattacggtaattataataaagctacagatcaagctaattttataaatgtagta
ggagattggatatattacagtaatttctctgatggacacaaaatatataccgtaaataag
gatggaaatataagaagaaaagtaaatgatgaatgggcagatggtatacaaatagtagga
gcatgggcatattactgctctggatccggtgctataagtaaagttagggtagatggtaca
ggctctgtaatacctttaagaggaactacaagaaaagtagacaagggatatcatttaaat
atagtagatggatggttatactatagtaatgcagaagacggcggaaaactctatagaata
aaagaagatggctctggagaaaagaaaaaattagcagatttagctacagattatataaat
atagtaggagacactatgtatctaattagtggtggaaaaacttatactcttccacttaat
acagatgggactataaaacctactttagtaactaaagataataatggtaatactgtagta
gatgttaaggatttaaatataactgtagcctatgaggatgctaataaaactataggagag
ttggaagctaaatatttaccacaaaaagttgcggtatttatgaaggatgatacagtacaa
caacttccagtagattgggatattaaaaatagaaaatataatggacaaggtatttatact
tatacaggtacagttttaggacatggtaaacagataaaatgcacattaactataccgtcc
gaaatgctaaatgcaactagtataatagaagtttataacaatggacctaaaaacggttct
ataatgataaaagaaagaagtttcggaccatcaaaacaggatcaagaattaaaagaaaaa
ttaaagcttgcaaaaagagtagaaataggagatgttataaaagtatatgacaatcctaat
agtgaaaaaccattaggaaatataaaagtagatgctaataatgctaatggtcctttggtt
aaatccttagatttagatatgtatggaagaagcttctggataactataacaagaaagaac
aaagcagaaagtaaaccaacagaagtaagacaactaggagctgctgtgctatcaggagat
gtgttagatgaagatggagaagcactaggagtagatggaagagattttactgtaaaggga
tggaataatccttctataagagatgatggttttatatcagatactacagaaatagctgct
caaggaacaaagagtatttatgttatccctggaacaggtaaattaaacatggaaaatcaa
ggtgttatacctgcaggaataactagcgcaaattattggaatggtggaaatgctagagct
ttacttactaattatgaccttttaaccaatgatagtttaaaaaataaactaaaagagggt
aactacagtatttatgtagtagtaggttatgatggaaaagcagaagaggatgtaaatgga
tttggatcaccacttgtaataggaaaaacagcaagtattccaaaggctatgaaagctaca
gaggaaaagattcctaaagctccaagtgtaactaagcaatatgctaaatcaggagatact
gtaaaaatatctggtgtaacaaatgaagatgaaatatatttagcaccagaaggagctagt
tatatagcaaaagatataactaataaaccatataaatctcacgacaacttattctttgaa
gatcaatctaagagtaaagaggagcgggaaaaggaatatgaaaaaagtggaaagccttct
atagaagatggatatcaatgtaaacttgtaaatggaaagatacctcagggtgttagatca
ggaaaatataaagtttatatggtaaatgccataggttcttctagtccagcttctggagaa
atcattgtagataatgaagatccagtagttagattggattctgctaaacaagaagatgta
ataaagactgtaacacaaaatggaactacaacacaagaaactacaggtcaaaaatttaaa
gtaaattttgcagcctttgataatagttttgacaatagtataaaagagggaataaccgtt
agcatggcaaggcttgatagtccaaagagtgctataaaagctcaagaaattaaggataag
ggaaataaaacatttgaggtaatcattaatgatccacatgctaatttaaatgattatgct
atatatgcagaagataaagcaggaaatattgggcaagtaaatcttaaagtacaagatcct
cctgctaatataaataatatatcattagctattagaacatctaatgaaggtgtagattta
gttaaatccagattagttggaagaacaaaatacatgacaaaagatttaacaagagctagt
gataattatgaagttactgtagatggagttaaatatgttctacaagaggaagctttaaga
aatttaggtacaagtccatctatagatgcttttatgaatgcacttatgcaggcaaaacaa
tgggatatagctaataataaaccaatggaagataaacctaaattaagctcaaaggtaagt
atatataaagtaaatgatgtaatatatatagaaggaaatgataatactcctatacaaata
gaggataaaaccaagatagattcagatactgctatagtaagcaatatgataggtttaaat
cctaatgaaaataatacaggagaaaattcaaaaaatcagcaatatgtaataaatgtaaca
ggaacagctcaaaagaatggtaaactaaaagtatgtctagcaggaaaatgttttgatatt
aatatggtagctggtgatagtagaactaatatagcagcaaaaattaaggaagctataaat
aacaatacaatattagatagttatcaatatccaggaacaaatgtggaatctaatggtagt
gaggttagattgactagaaaatctccaggagctgtagtgcctacatttactgtagaatac
tttaattatgataattag

DBGET integrated database retrieval system