KEGG   Clostridium botulinum A Hall: CLC_1732Help
Entry
CLC_1732          CDS       T00575                                 

Definition
(RefSeq) small, acid-soluble spore protein alpha
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1836172..1836375
Genome map
AA seq 67 aa AA seqDB search
MPSNKNSNNLVVPEAQQGLNQLKMEVANEVGIANYDSMDKGNLTSRQNGYVGGNMVKKMV
EAYERNL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaataaaaattctaataatttagtagtgccagaagcacaacaaggattaaac
caactaaaaatggaagttgcaaacgaagtaggaatagcaaactatgattcaatggataaa
ggaaacttaacttcaagacaaaatggatatgtaggcggaaacatggttaaaaagatggta
gaagcttacgaaagaaatctataa

DBGET integrated database retrieval system