KEGG   Clostridium botulinum A Hall: CLC_1734Help
Entry
CLC_1734          CDS       T00575                                 

Definition
(RefSeq) hesB family protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5400871
NCBI-ProteinID: YP_001387590
Position
complement(1836840..1837169)
Genome map
AA seq 109 aa AA seqDB search
MILVNMSDLAYKEFKNFIKENNVNSNIFRIFLAGNGUGGPVFNIVLDEQTSEDLLSPIGE
LSFLVHKDLFSEFGGFIIKCAEENGKGGFTIDPIIQSENISCSTCSSCS
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgatcctagttaatatgagtgatttagcttataaagagttcaaaaattttataaaggaa
aataacgtaaactcaaacatatttagaatatttttagctggcaatggctgaggtggtcca
gtttttaatattgttctggatgaacaaacaagcgaggatttactatcacctatcggagaa
ttatcatttttagtacataaagatcttttttcagaatttggaggctttataattaaatgt
gcagaagaaaatggcaaaggtggatttactatagatccaataatacagtcagaaaatatt
agttgttctacttgttcaagttgcagttaa

DBGET integrated database retrieval system