KEGG   Clostridium botulinum A Hall: CLC_1750Help
Entry
CLC_1750          CDS       T00575                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  
CMP/dCMP kinase [EC:2.7.4.25]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLC_1750 (cmk)
Enzymes [BR:cbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     CLC_1750 (cmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1857435..1858088)
Genome map
AA seq 217 aa AA seqDB search
MLDISIAIDGPAGAGKSTIAKIIGNKLNIMYINTGSMYRAVTLMALKNNIEPYDIESLKA
LINSMNISFNGNNIIVNGKDLEEDIRMPIINNNVSKYAAVEEVRELLVSMQQNISKKYNV
VMDGRDIGTVVLKDAPYKFFITASAEVRAKRRLKELKEKGININFRDVLKEIKERDYIDS
NRKVNPLKQSKDAILIDTSNFTIEEVVDKICTIIKKD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgttggatatatctatagccatagatggccctgcaggagcagggaaaagcaccatagca
aaaattattggaaacaaattaaatataatgtacataaatacaggttctatgtatagggca
gtaacccttatggccttaaaaaataatatagaaccctatgatatagaaagccttaaagct
ttaattaattccatgaatataagttttaatggtaataatataattgttaatggaaaagac
ttagaagaagatataagaatgcctataataaataataatgtatctaaatatgcagcagtt
gaagaagttagggaacttttggtttctatgcaacaaaatataagtaaaaaatataatgta
gtaatggatgggcgagatataggtactgtagttcttaaggatgccccttacaaatttttt
attacagcaagtgcagaagttagggcaaaaagaaggttaaaagaattaaaagaaaaagga
ataaatataaattttcgggatgtactaaaggaaattaaagaaagagattatatagacagc
aatagaaaagttaatcccctaaaacaaagtaaagatgctattttaatagatacttctaat
tttactatagaagaagtagttgataaaatatgtaccataataaaaaaagattaa

DBGET integrated database retrieval system