KEGG   Clostridium botulinum A Hall: CLC_1762Help
Entry
CLC_1762          CDS       T00575                                 

Definition
(RefSeq) thioredoxin family protein
  KO
K03671  thioredoxin 1
Organism
cbh  Clostridium botulinum A Hall
Brite
Chaperones and folding catalysts [BR:cbh03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CLC_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_3 Thioredoxin_8 Thioredoxin_9 Thioredoxin_6 TraF DUF836 HyaE YtfJ_HI0045 KaiB Glutaredoxin Redoxin AhpC-TSA Polysacc_deac_2 Shisa ParE-like_toxin DUF496
Motif
Other DBs
NCBI-GeneID: 5401703
NCBI-ProteinID: YP_001387617
UniProt: A5I2U2
Position
complement(1872030..1872461)
Genome map
AA seq 143 aa AA seqDB search
MKKGVKLFIIFILIVIIAIMAWFKAVKPKEEYSNIGGNSVKEENIDYEANVGKMPVLLEL
SSPTCGPCRKMTPIIKEVKEKYKDTVDTHIIDLTKNPEFGEKYKVSVVPTQVFLDKEGKV
FFRHEGMLTKEEIVDILNKMGVK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggcgttaaattatttataatatttatcttaattgttattatagcaattatg
gcttggtttaaagctgttaaacctaaagaagaatattcaaatataggaggaaattcagta
aaagaggaaaatattgattatgaagctaatgtaggtaagatgcctgtattattagaatta
agttcgccaacctgtggaccttgcagaaaaatgacacctattataaaggaagtaaaagag
aaatacaaagatacagtggatactcacataatagatttaactaaaaatcctgaatttgga
gaaaaatataaagtttcagtggttccaacacaagtatttttggacaaagagggaaaggta
ttttttagacatgagggtatgcttacaaaagaagaaattgtagatatattaaataaaatg
ggtgtaaaataa

DBGET integrated database retrieval system