KEGG   Clostridium botulinum A Hall: CLC_1768Help
Entry
CLC_1768          CDS       T00575                                 

Definition
(RefSeq) lipoprotein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1877249..1877743)
Genome map
AA seq 164 aa AA seqDB search
MKKKIVALLLSVVALFSFIFVGCSQNTATNADKKEETKQEDKKDDASKKFNYIKADELKS
KIEKKEKIIILDIQVKDEFAKHHIKDAIETNAYPAKTDEDKAKLDKVMDKLTSSEDPIAI
ICPKGKGGAEKTYNYLKEKGIKEDRLLILEKGQAGWTHEDLLEK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaattgtagccttattattatctgtagtagctttattttcttttattttc
gtgggatgtagccaaaatacagctacaaatgctgataaaaaagaagaaactaaacaagaa
gataaaaaggatgatgcatctaaaaagtttaattacataaaagcagatgagttaaaatca
aaaattgagaaaaaagaaaaaattataatcttagatattcaagtaaaagatgaatttgct
aaacaccatataaaagatgctatagaaactaacgcatatccagctaaaactgatgaagat
aaagcaaaacttgataaggtgatggacaagcttacatcttcagaagatccaatagctatt
atctgtccaaaaggaaaaggtggagcagaaaaaacttataactatctgaaagaaaaagga
ataaaagaagatagattacttatactagaaaaaggacaagctggttggacacatgaagat
ctattagaaaaataa

DBGET integrated database retrieval system