KEGG   Clostridium botulinum A Hall: CLC_1780Help
Entry
CLC_1780          CDS       T00575                                 

Definition
(RefSeq) heme/steroid binding domain-containing protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1889361..1889876)
Genome map
AA seq 171 aa AA seqDB search
MEYNDCVFSKLFICCNRISYYNQMLLFSQSLSQIKFYTELIEKELIELKKSRKYCENSFK
ISENNRFNYNDFSYSSKGTKPIQNNRYNEDNNMTRQKEFTLEELKKYDGSNGNPAYAAVS
GIVYDVSYEATWAGGTHFGLYSGKDLSNEFLGCHKGMAEILNKLPKVGTIK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaatataatgattgtgtattttctaaactttttatctgttgtaataggatatcttat
tataaccaaatgctactttttagccaaagcttatcacaaataaaattttatacagaacta
atagaaaaagaattaattgaactaaaaaaatcaagaaaatattgtgaaaatagcttcaaa
atatcagaaaataataggtttaattataatgatttttcctatagttcaaaaggaactaaa
cctatacaaaataatagatataatgaagataacaatatgacaagacaaaaggaatttaca
ttagaggaattaaaaaaatatgatgggagtaatggaaatccagcttacgcagcagtaagt
ggtatcgtatatgatgtaagctatgaagctacttgggctggtggaactcatttcggtctt
tattctgggaaagatttaagtaatgaatttttaggttgccataaagggatggcagaaatc
ttgaataaattacctaaagtgggtactatcaagtaa

DBGET integrated database retrieval system