KEGG   Clostridium botulinum A Hall: CLC_1783Help
Entry
CLC_1783          CDS       T00575                                 

Gene name
hupS
Definition
(RefSeq) [Ni/Fe] hydrogenase, small subunit
  KO
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLC_1783 (hupS)
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     CLC_1783 (hupS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1892002..1892874)
Genome map
AA seq 290 aa AA seqDB search
MNNSFCPLIERKDTTSKMLCKEAMELINHRKIKKVNAIWLEVTGCSGNIISLLNAENPGL
IYILRNIVNLTFNNSLMGAEGEFAYEQFLNTLDTEFILLVDGAVSTKENGYYNIIANYRG
RPVTALEAIKMAGEKAKYVVTVGTCSSYGGISAAKPNPSGSKSVDAVINKEVIKLPGCPC
HPDWVVGTLAHLVTYGKPELDNKGRPILFYGITIHDSCTRRGFFDKRIFAKKFGEEGCMF
KLGCRGPVTKTDCPRRKWNGYVNWPIGDNTNCIGCAQERFPDGMEPFVRY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagcttttgcccattaattgaaaggaaagataccacttcaaaaatgctttgc
aaagaagctatggaattaattaatcatagaaaaataaaaaaagtaaatgctatatggcta
gaagtaacaggctgttccggaaatataatttctcttttgaacgcagaaaatccagggctt
atttatatacttagaaatatagttaatttaacttttaataattctttaatgggagctgaa
ggagaatttgcatatgaacagtttttaaataccttggacacagaatttatattattagta
gatggagctgtgtccactaaagaaaatggctattataacattattgctaattatagagga
aggcctgttaccgcattagaagcaataaaaatggcaggtgaaaaagcaaaatatgtggta
actgtaggaacctgttcttcttatggtggtatttctgcagctaagcctaatccttctggt
agcaaaagcgtagacgctgttataaataaagaagtaataaaattaccagggtgtccttgt
catcctgactgggtggtaggtactttagctcatctagttacttacggtaaaccagaatta
gataataaagggagacctatattattttatggaataactattcatgatagttgtacaaga
agaggcttttttgataaaagaatctttgccaaaaaatttggagaagaaggatgtatgttt
aagttaggatgtagaggacctgttacaaaaacagattgccccagaagaaaatggaatggt
tatgtaaattggcctattggagacaacacaaattgtataggctgtgcccaagaaagattt
ccagatggtatggagccctttgttaggtattaa

DBGET integrated database retrieval system