KEGG   Clostridium botulinum A Hall: CLC_1794Help
Entry
CLC_1794          CDS       T00575                                 

Definition
(RefSeq) ADP-ribosylglycohydrolase
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 5398880
NCBI-ProteinID: YP_001387649
UniProt: A5I2X4
Position
complement(1904640..1905518)
Genome map
AA seq 292 aa AA seqDB search
MDTKTRILGGLFGVACGDALGITLENMDKEEIHNYGYLKEIVGGGVFDLKPGCTTDDTLM
VLCVAKGILNNPEDPQDSIGNEFMKVYQDLMKYGGTTVKCTIEKFLECRDWYEASLHSSE
VLSWQAAGNGALKRSLPVALYYKDYDEVIKITKEQSQLTHRSKIGERTCLLYNTLIYYYI
KGYDKNEALKLALKEFDEFYEITNINKYSLNSSLFAVDSLMCAIWSIMNTTTAEEAICEA
VNLGGDAGSIGAITGGLAGVYYGYDALPKRWTDIIDKKQELLDIALKLSENG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaaactagaatattaggaggtttatttggagtagcctgtggagatgcttta
ggtataacattagaaaatatggataaagaagaaattcataactacggatatttaaaagaa
atagttggtggtggggtttttgatctaaagccaggatgtacaacagatgatactttaatg
gtattatgtgtagccaaaggaatattaaataacccagaagatccacaagatagtatagga
aatgaatttatgaaagtataccaggatttaatgaaatatggaggcacaactgtaaagtgt
actatagaaaaatttttggaatgtagagactggtatgaagctagtttacacagcagtgaa
gtacttagctggcaagctgctggtaatggagccttaaaaagaagtctgcctgtagcttta
tattataaagattatgatgaagtaattaaaataacaaaagaacaatctcaattaactcat
agaagtaaaattggagagagaacttgccttttgtataatacattaatctattattatata
aaaggttatgacaaaaatgaagcattaaagttagcacttaaagaatttgatgaattttat
gaaataacaaatataaataaatactcactaaattcatcactttttgcagtagattcatta
atgtgtgctatttggagtattatgaatacaactacagcagaagaagctatatgtgaagcc
gttaatttaggtggagatgctgggagtataggagcaataactggaggactagctggtgta
tattatggatatgatgccttaccaaaaagatggacagacataatagataaaaaacaagaa
ttattagatatagccttaaaactaagtgaaaatggttag

DBGET integrated database retrieval system