KEGG   Clostridium botulinum A Hall: CLC_1801Help
Entry
CLC_1801          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1910658..1911248)
Genome map
AA seq 196 aa AA seqDB search
MIELYSLCTEENWTEAIKKCYKYNLLDINLNLLGLENILLDYSNIYVRILNVLYSIKGEH
GQSIFIDNSFLNKDLRKPIDKYLQNKEIYSLSLSNAKDNYEIYKILSKTYSFERVLLAWN
LKFRYKVYNYEKNIRVIDLTMNGQDIKELGIKEGKEIGLILEYMKKYKINLGLLDEENFL
IDNMGEIKNAIKYKNT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatagaattatatagcttatgtaccgaagagaattggacagaagctataaagaaatgt
tataaatataatttattagatataaatctaaacttattaggattagaaaatattttatta
gattattctaatatttatgttagaatattaaatgtactttattcaataaaaggtgaacat
gggcaaagtatttttatagataattccttcctaaataaagatttgagaaagcctatagat
aaatatttacagaataaagaaatttatagtttaagtttatctaatgccaaggataactat
gaaatttataaaatattaagtaaaacttatagctttgaaagagttttattagcttggaat
ctaaaatttagatataaagtatacaattatgaaaaaaatataagagtaatagatttaact
atgaatggacaggatataaaggaattaggtataaaagaaggaaaagaaataggattaata
ttagaatatatgaaaaaatataaaattaatttaggattattagatgaagaaaatttttta
atagataatatgggagagataaaaaatgccattaaatataaaaatacataa

DBGET integrated database retrieval system