KEGG   Clostridium botulinum A Hall: CLC_1802Help
Entry
CLC_1802          CDS       T00575                                 

Gene name
dacF
Definition
(RefSeq) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00550  Peptidoglycan biosynthesis
cbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLC_1802 (dacF)
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CLC_1802 (dacF)
Peptidases [BR:cbh01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CLC_1802 (dacF)
Peptidoglycan biosynthesis and degradation proteins [BR:cbh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CLC_1802 (dacF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-GeneID: 5400162
NCBI-ProteinID: YP_001387657
UniProt: A5I2Y2
Position
complement(1911461..1912684)
Genome map
AA seq 407 aa AA seqDB search
MKRKIYYFFSVIITITFIFGVFVTPVSAYDQQNQLKKEEKAEDKDSNKEGDSDVDAKSAL
LIEPTTGKVIYEKNPHEKFAPASVTKIMTMLLSMEAVDSGKIKLTDKVTISENAKKMGGS
TMLLDVGEERTVEDLLKGIAIASGNDAAVAMGEYLAGSEEAFVKMMNDRAQKLNMKDTSF
KNCTGLSAEGHKTSAYDISIMSRELLKHKQILKYTGTYMETISEGRKSPIGLVNHNKLVR
FFKGCDGLKTGFTDEAKYCISATAKKDGVRMLAVIMGAPTYKIRNKDASKLMNYGFSKFE
CKTLVKKGDVISKVPLNSKGDKYFMAKSCEELDAIIEKGKKTKITNKCIIDENKKEYKIN
EEVGICEFYSDGNLIGKVKITSDRNIRKSGIFNHFKGGFERLIDKGI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaatttattactttttcagtgtaataattaccataacttttattttcggt
gtgtttgtaacaccagtaagcgcatatgaccaacaaaatcagttaaaaaaagaagaaaaa
gcggaagataaagattctaataaagaaggtgattcagatgtagatgctaaatcagcactt
cttattgaacctacaacaggaaaggttatttatgaaaaaaatcctcatgaaaaatttgct
ccagcatcagttacaaaaattatgacaatgcttttatcaatggaagcagtagatagtggc
aaaataaagttaactgataaagttactataagtgaaaatgctaaaaaaatgggtggaagt
accatgcttttagatgtaggagaagaaagaactgttgaagaccttttaaaaggtatagca
atagcttctgggaatgatgctgcagtagctatgggagaatacttagcaggaagcgaagaa
gctttcgtaaaaatgatgaatgatagagcacaaaaattaaatatgaaagatacgtctttt
aaaaattgtactgggcttagtgcagaaggtcacaaaacttcagcctatgatatatctata
atgtcaagagaactattaaaacataagcaaatattaaaatatacaggaacatatatggaa
accatatcagaaggaaggaaaagtcctataggattagtaaatcataataaacttgttaga
ttttttaaaggctgtgatgggctaaaaacaggatttacagatgaagctaaatattgtata
tcagccacagcaaaaaaagatggagtaagaatgttagcggtaataatgggagctccaact
tataaaataagaaataaagatgctagtaaacttatgaattacggattttcaaaatttgaa
tgcaaaactttagttaaaaaaggagatgtaatatcaaaggtacctttaaattctaaagga
gataaatactttatggcaaaatcctgtgaagaattagatgctataatagaaaaaggtaag
aaaacaaaaataactaataaatgtattatagatgaaaataagaaagagtataaaataaac
gaagaagttggtatatgtgagttttattcagatggtaatttaataggtaaagttaagata
acttctgatagaaatataagaaaatcaggaatttttaatcactttaaaggtggatttgaa
aggttaatagataagggtatataa

DBGET integrated database retrieval system