KEGG   Clostridium botulinum A Hall: CLC_1803Help
Entry
CLC_1803          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EcsC
Motif
Other DBs
NCBI-GeneID: 5401696
NCBI-ProteinID: YP_001387658
UniProt: A5I2Y3
Position
complement(1912807..1913529)
Genome map
AA seq 240 aa AA seqDB search
MTKYEIDAINELNIFKKEMTKRDSIVYKITKKVQNKTNSFIPEKVHMVITEGVKNMIKVV
LFTSKYVTVKPPKLANLEERENLAYEKLNLYRKTATISGAGTGLGGLMLGLADFPILLTI
KINFLFNLASIYGIDAKEYKERLYILYIFQLAFSEGYERRKTYNKIINWSSYSEKLPDNI
NDFNWREFQQEYRDYIDFSKMLQIIPGIGAPIGAYANYKLMNKLAYVAINCFRMRYFSLN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatatgaaatagatgctataaatgagttaaatatatttaaaaaagaaatgact
aaaagagattctatagtttataaaattacaaaaaaagttcagaataaaaccaatagcttt
attcctgaaaaagtacatatggtaattactgaaggagttaaaaatatgataaaggttgta
cttttcacctctaaatatgttactgtgaaacctcctaaattagccaacttagaagaaagg
gaaaatttagcttatgaaaagttaaatttatataggaaaacagcaacaatcagtggagca
ggtacaggattaggtggtttaatgttaggtcttgcagatttccccatattgttaacaatt
aaaattaattttttatttaatttagctagtatatatggtattgatgctaaggaatataaa
gaaagattatatattctatatatttttcaattagctttttcagagggatatgagagaaga
aaaacctataataaaattataaattggagtagttatagcgaaaaattaccggataatatt
aatgattttaattggagagagtttcagcaagaatatagagattacatagatttttcaaag
atgctccaaattattcccggtataggtgccccaataggtgcttatgcaaattataaattg
atgaataaattagcttatgtagctattaattgttttagaatgagatatttttctttaaat
taa

DBGET integrated database retrieval system