KEGG   Clostridium botulinum A Hall: CLC_1804Help
Entry
CLC_1804          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos DUF3951 DUF1206 NusG_II
Motif
Other DBs
NCBI-GeneID: 5398442
NCBI-ProteinID: YP_001387659
UniProt: A5I2Y4
Position
complement(1913688..1914746)
Genome map
AA seq 352 aa AA seqDB search
MKKIGQVLLGIIILVILIIAGYILFMTVTDYKPEDKIHLSIEGQTEDRLNLKDSFSIVTF
NIGYGGMDDKQDFFMDGGKGSRSSSKEKTMENMRGITSFLKKDNSSFIFLQEVDTNSTRS
FRIDQYDYLKNSLKAYSSSMALNYKTPWVPVPILKPHGTVNAGLVNLSKYKINSATRYQY
PGKESWPRQLAELDRCFLESRVSLENNRELVLINSHLSAYDKGGKIRKQQLSFLKNYIIK
EYKKGNYIIVGGDWNHLIPGTDPLMFKTTEKWPDWLQKIPNDFKPEGFKWVADKNVPTTR
TDATPYKKGENFTAVIDGFLVSDNIEATSVKAYSMEFKNTDHNPVKMEFKLK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatcgggcaagttttattgggcataattattttagttatattaattatagca
ggatatatcttatttatgacagtaacggattataaaccagaggataagattcacttatct
attgaaggacaaacagaggatagattaaacttaaaggacagtttttccatagttactttt
aatataggctatggtggtatggatgataaacaagatttttttatggatggaggtaaaggt
tccagatcatctagcaaagaaaaaaccatggaaaatatgaggggaattacgagttttttg
aagaaagataacagctcttttatatttttacaagaggtagacactaattcaactagaagt
tttagaatagatcaatatgattacttaaaaaatagcttgaaagcatattcttcaagtatg
gcattaaattataaaacgccttgggtaccagtacctatattgaaaccacatgggactgtt
aatgcaggattagtaaatttatctaagtataaaattaattcagccactagatatcaatat
ccaggtaaagaaagttggccaagacaattagcagaattagatagatgttttttagaatct
agagtatctctagaaaataatagggaattagttcttataaattctcatctatctgcttat
gataaaggtggcaaaataagaaagcaacaactttcttttttaaaaaattatataataaaa
gaatataaaaaagggaattatattatagtaggtggagattggaatcacttaataccggga
acggatcctttaatgtttaaaactacagaaaagtggccagattggcttcaaaaaatacct
aacgattttaaaccagagggatttaagtgggtagcagataaaaatgttccaaccactcga
acagatgctacaccttataaaaaaggagaaaactttacagctgttatagatggattttta
gtatcagataatatagaagctacaagtgtaaaagcttattcaatggaatttaaaaataca
gatcataatcctgttaagatggaatttaaattaaaataa

DBGET integrated database retrieval system