KEGG   Clostridium botulinum A Hall: CLC_1809Help
Entry
CLC_1809          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5400799
NCBI-ProteinID: YP_001387664
UniProt: A5I2Y9
Position
complement(1918613..1918840)
Genome map
AA seq 75 aa AA seqDB search
MFIEYKKAIVTLIKCFLILLFFGSLLPIALDSVLYNFFMKNKVYENSTLVFKNIDLKIKI
IYNYILVFNNFLRGF
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagaatataaaaaagccatagtcactttaataaagtgttttttaatattattg
ttttttgggtccctattgcctatagccttggattcagttctttataatttttttatgaaa
aataaggtatatgaaaatagcactttagtatttaaaaatatagatttaaaaataaaaatt
atatataattatatactagtttttaataattttttaagaggtttttaa

DBGET integrated database retrieval system