KEGG   Clostridium botulinum A Hall: CLC_1810Help
Entry
CLC_1810          CDS       T00575                                 

Definition
(RefSeq) sporulation protein
  KO
K06384  
stage II sporulation protein M
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1918831..1919484)
Genome map
AA seq 217 aa AA seqDB search
MENKFLGNINRHVQENFWLYIISLLCICTGIVLGIYSVKYMGSFEKGDLLSYVESFSKSI
SSNGIDSKSILFEAIKNNITIIVAIWFLGLTMIGIPVILIIDVIKGFTIGFTTSFIVNGL
GMKGIWMSLLGVLPQNLIYIPCIIFASVLSMEFSIQILRDKNNRGFQNGIWVRATSYSFS
FAFVVIIMFIGFLMESYITPNMIKLVVARAGVCMLCL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaatttttgggtaatataaacagacacgttcaagaaaatttttggctatat
attataagtcttttatgtatttgtactggtatagtcttaggtatatactcagtaaaatat
atgggttcttttgagaaaggtgatcttttaagttatgtagagagttttagtaaaagcatt
tcatctaatggaatagattctaaatcaattttatttgaagctataaaaaataatataact
attattgtagctatttggtttttaggattaactatgataggaattccagttattctcata
atagatgtaataaaaggattcacaataggttttaccacaagctttattgtaaatggattg
ggaatgaaggggatatggatgtcccttttaggggtattacctcaaaatttaatatatatt
ccttgtataatatttgcatcagtgctatcaatggaattttcaatacaaatactaagggat
aaaaataataggggatttcaaaatggaatatgggtaagagctacctcctattctttttct
tttgcatttgtagtaataattatgtttataggatttttaatggaatcttatataacaccc
aatatgataaaactagtagtagcaagagcaggggtttgtatgctatgtttatag

DBGET integrated database retrieval system