KEGG   Clostridium botulinum A Hall: CLC_2050Help
Entry
CLC_2050          CDS       T00575                                 

Gene name
eutE
Definition
(RefSeq) acetaldehyde dehydrogenase (acetylating)
  KO
K00132  acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00620  Pyruvate metabolism
cbh00650  Butanoate metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLC_2050 (eutE)
   00650 Butanoate metabolism
    CLC_2050 (eutE)
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLC_2050 (eutE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Cyclin_C
Motif
Other DBs
NCBI-GeneID: 5400616
NCBI-ProteinID: YP_001387897
UniProt: A5I3M9
Position
complement(2176868..2178466)
Genome map
AA seq 532 aa AA seqDB search
MENFDKDLRSIQQARDLARLGKVAADKIADYTEEQIDKILRNMVRVAEENAVCLAQMAVE
ETGFGKVEDKTFKNHLAATILYNSIKDMKTIGVINEDKENKLIELAEPVGLVMGIVPSTN
PTSTAIFKAMISIKSRNAIVFAPHPAAAKCTIKAVELMRDAAIEAGAPENIISAVTIPTI
GATNELMKSKEVAIIIATGGPGMVKAAYSSGTPAIGVGAGNSPAYIERTANVEKAVKNII
ASKTFDNGTICASEQSIICEECNHDLVVAEFKKQGGYFMTEEETEKVCKLLFKKGNAMNA
KFVGRSPQVIASAAGFTIPAGTKVLIGRQNGVGEGYPLSFEKLTTVLGFYTVKDWHEACE
LSIKLLQNGIGHTISIHTEDRDMVMKFARKPASRILVNTGGTQGGTGASTGLNPSFTLGC
GTWGGSSVSENVTPKHLMNIKRVAYGIKDCTNLASNDPTFNCIKTAENCHGVQNQFMNMS
PAQIAAAAEVLNKANNCAENTNTCTECSNENTKNEELLDLVNQIVAAMKGAN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactttgataaggatttgcgttcaatacaacaagcgagagatcttgctagactt
ggaaaagtagcagctgataaaattgctgattatactgaagagcaaattgacaaaatttta
cgtaatatggtaagagttgcagaagaaaacgctgtttgtttagcacaaatggcagttgaa
gagacaggctttggtaaagttgaagataaaactttcaaaaaccacttagcagctactata
ctttataattcaattaaagatatgaaaactataggtgtaattaatgaagataaggaaaat
aagcttatagaacttgctgaaccagttggcttagttatgggtatagtaccttcaacaaac
ccaacttctaccgcaattttcaaagctatgatttcaatcaaatctcgtaatgctatagtg
ttcgcaccacatccagctgctgcaaaatgtacaattaaagcagttgaattaatgagggat
gcagcaatagaagctggagcaccagaaaacattataagtgctgtaactattccaacaatt
ggagctacaaatgaattaatgaaaagcaaagaagtagctataataatagctacaggtggt
ccaggaatggttaaagctgcttatagctcaggaacaccagctattggtgttggtgcagga
aactctccagcatacattgaaagaactgctaatgtagaaaaagctgttaaaaacattatt
gcaagtaaaacttttgataatggtacaatctgtgcatcagaacaatcaataatctgtgaa
gaatgtaatcatgacctagttgttgcagaatttaaaaaacaaggtggatacttcatgaca
gaagaagaaactgaaaaagtttgtaaactattattcaaaaaaggtaatgctatgaatgct
aaatttgttggaagaagtccacaagttatagcaagtgctgcaggattcacaattccagca
ggaactaaagtacttataggaagacaaaatggagtaggagaaggttacccattatctttt
gaaaaacttacaacagttcttggattctatacagtaaaagattggcatgaagcatgtgaa
ttaagtattaaattacttcaaaatggaattggtcacacaattagcatccatacagaagat
agagacatggttatgaagtttgctagaaaaccagcttcccgtatccttgttaacactggt
ggaactcaaggtggaacaggtgcaagtacaggtcttaatccttcatttactttaggatgc
ggtacttggggaggaagctcagtatctgaaaatgttactccaaagcaccttatgaacatt
aaaagagttgcttatggtataaaagattgcacaaatttagcatctaatgacccaactttt
aactgcataaaaactgctgaaaactgtcatggagttcaaaatcaatttatgaatatgagc
ccagcacaaattgcagcagctgcagaagttttaaataaggctaataattgcgctgaaaac
actaatacttgcactgaatgcagtaatgaaaatacaaaaaatgaagaacttttagattta
gttaatcaaatagttgccgctatgaagggggcaaactaa

DBGET integrated database retrieval system