KEGG   Clostridium botulinum A Hall: CLC_2273Help
Entry
CLC_2273          CDS       T00575                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00900  Terpenoid backbone biosynthesis
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLC_2273 (dxr)
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CLC_2273 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh DapB_N Glycoprotein Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 5399283
NCBI-ProteinID: YP_001388117
UniProt: A5I4K2
Position
complement(2404558..2405715)
Genome map
AA seq 385 aa AA seqDB search
MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSDKKVIEIIKEFKPKYAVLMEEN
AFKIVEDFCIDNKIDTKVLKGMEGMIYISTLEEVNTVVTSVVGMIGLVPTIKAIESGKDI
ALANKETLVVAGELVISKAKEHNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPF
RGKKKEELIDVKPEHALKHPKWNMGRKISIDSATLMNKGLEVIEAHFLFGVDYENIKVVV
HPQSIVHSMVEYKDGSVIAQMATPDMKLPIQYALNYPNRKESQIEPLDFYKISNLTFEKP
DMDTFLPLKLAYEAGKKGGVMPAILNGANEVAVDLFLKGKIEFLQIGDLLQECMNKFYKS
MEATLENVISVDKEVREYLGKKYDI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaacattaccatattaggcgcaacaggctctattggaacccaaactttagatgta
ataagaagagaaaaggaagaattaaaattagtagccatatccgcgaataaaagcgataaa
aaagttatagaaattataaaggaatttaaacctaaatatgcggttttaatggaagagaat
gcttttaaaatagtagaagatttttgtatagataataaaatagatacaaaagttttaaaa
ggtatggaaggaatgatatatataagcaccttagaggaggtaaatacagtagttacctct
gtggtaggaatgataggattagttccaaccataaaagctatagaaagtggaaaagatata
gctttagctaacaaagaaaccttagtagtagctggagaactagttattagtaaagctaaa
gagcataatgtaaatatattacctgtagattcagaacacggagctatttttcaatgttta
agaggaaataaaaaggaagaagttaaaaatataatagtaacagcttcaggaggacctttt
agaggtaaaaagaaggaagaactcatagatgtaaagccagagcatgctcttaaacatcct
aaatggaatatgggaagaaaaatatctatagattctgccacattaatgaataaagggtta
gaggttatagaagctcactttttatttggtgtggattatgaaaatataaaggtggtggta
catccacaaagtatagtccattctatggtagaatataaagatggaagtgtaatagcacaa
atggcaactccagatatgaaattacctatacaatatgctttgaattatcctaataggaaa
gaaagtcaaatagaacctttagatttttataaaatatctaatttaacctttgaaaaaccg
gatatggatacattcttaccactaaagttggcttatgaagcagggaaaaaaggtggagta
atgccagccatattaaatggggccaatgaggttgcagtagatttatttttaaagggcaaa
atagaatttttacaaataggtgacctattacaagaatgtatgaataaattttataaatct
atggaagctacattagagaatgtaataagtgtagataaggaagttagagagtatttaggt
aaaaaatatgatatataa

DBGET integrated database retrieval system