KEGG   Clostridium botulinum A Hall: CLC_3016Help
Entry
CLC_3016          CDS       T00575                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00040  Pentose and glucuronate interconversions
cbh00052  Galactose metabolism
cbh00500  Starch and sucrose metabolism
cbh00520  Amino sugar and nucleotide sugar metabolism
cbh01100  Metabolic pathways
cbh01130  Biosynthesis of antibiotics
Module
cbh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLC_3016 (galU)
   00052 Galactose metabolism
    CLC_3016 (galU)
   00500 Starch and sucrose metabolism
    CLC_3016 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CLC_3016 (galU)
Enzymes [BR:cbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLC_3016 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 5401538
NCBI-ProteinID: YP_001388843
UniProt: A5I6J3
Position
complement(3180479..3181375)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNK
RAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFV
GNEPFAVMLGDDVVYSDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIVKGMFIEDR
IYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKE
AMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNTNFVKYLQQLKNNEEFTALFKTE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggccataattcctgcagcaggattgggaacaagatttttacctgca
actaaagctcaacctaaagaaatgttacctatagttgataaaccaactatacaatatata
atagaagaggctgtaaaatccggtatagaacaaatattaataataactggaagaaataaa
agagctatagaagatcatttcgataaatctgtagaattggaaaaggaattagaagaaaaa
ggtaaagctgaaatgctttctatggttaaggatatatctaatatggctgaaatatattat
ataagacaaaaagaacctaaaggattagggcatgctataagttgtgctaaaacttttgtt
ggcaatgaaccttttgcagtaatgttaggagacgatgtagtctatagtgataaaccatgc
ttgaagcagcttataaaatgctacaatgaatatcaaacaactatagtaggtgtacaagaa
gtaccagaggaagatgtacataaatatggtattgtgaaaggtatgtttatagaagataga
atatataaaataaaagatttagtagaaaaaccacctaaggaagaagctccatctaatatg
gctatattagggagatatattataagtcctgctatatttgatattttagaaaatacaaaa
ccaggtaaaggtggagaaatacagcttacagatgcattgagaacattgattaataaagag
gccatgtatgcatataattttgagggtagaagatatgatgttggagataaactaggattt
cttcaggctactgtagagtatgcactgagaagagaaaagttaaatacaaatttcgtcaaa
tatctacaacaattgaaaaataacgaagaatttacagcactatttaaaactgaataa

DBGET integrated database retrieval system