KEGG   Clostridium botulinum A Hall: CLC_3288Help
Entry
CLC_3288          CDS       T00575                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLC_3288
  Amino acid metabolism
   00300 Lysine biosynthesis
    CLC_3288
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CLC_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3446096..3447487)
Genome map
AA seq 463 aa AA seqDB search
MEINKIIEELKDDLIDSTAELVKIKSIEDEAKEGKPYGEGVASALEKALEISEKLGFETV
NVDGYVGYAEYGEGDEYVGVLGHLDLVPEGDGWKYPPYGAEIHDGKMYGRGTTDDKGPIM
AALYGLKAIKESKLPLSKKVRILFGTNEETGSKEIEHYLEKEKPPVLGFTPDAEYPIIYA
EKGITIFDVVKKLEIKSSKAIKLKYIKGGEASNMVPDYCEAGIECPDTDMIIRSLEYCAN
RNGIELTAEEKGGLVVIKSFGLSAHGSTPEIGKNAIMQMFKFLAELPLGHCDELQFIRFF
NNNVGNETDGKTFGVELEDEPSGKLSFNVGTISMENNKIRMSLNLRYPVTYKSEDLMEKF
NKKIDGTGIKVENFEDQKPLYFDAEHQLIKSLQKVYKEQTGKEPELLAIGGGTYAKEMPN
MVAFGPLFPGEPDVIHKKDEYIELENLVLNAKIYGHAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggagataaataaaataatagaagagctaaaagatgatcttatagactctactgcagaa
ttagttaaaattaagagtatagaagatgaagcaaaggaaggtaaaccttatggggaaggc
gtagccagtgctttggaaaaagcattagaaataagtgaaaagctaggttttgaaactgta
aacgtagatggatatgttggatatgctgaatacggtgaaggtgatgaatatgtaggtgtt
ttaggtcatttggatttagtaccagaaggagatggatggaagtatccaccttatggagca
gaaatacatgatggaaaaatgtatggtagaggaactacagatgacaaggggcctataatg
gcagcactttacggtttaaaagccataaaagaatcaaaacttcctttatctaaaaaggtt
agaatcttgtttggaacaaatgaagaaacaggttctaaagaaatagaacattatttagaa
aaggaaaaaccaccagtacttggatttactccagatgctgagtatccaataatctatgct
gaaaaaggaattacaatatttgatgtagtaaaaaaattagaaataaaaagtagtaaagct
attaaattaaaatatattaaaggtggagaagcatctaatatggtgccagattattgtgaa
gctggtatagaatgtccagatacagatatgataataagatctttagagtattgtgctaat
agaaatgggatagaattaacagcagaagaaaaaggtggtttagtagtaattaaatctttt
ggactatccgctcatggaagtacaccagagattggtaagaatgctataatgcaaatgttt
aaatttttagcagaacttccattaggtcattgtgatgaattacaattcataagatttttt
aataataatgtaggaaatgaaactgatggtaaaacttttggtgtagagctagaagatgaa
ccatcaggtaagttaagttttaatgtaggaactatttctatggaaaataataaaataaga
atgtcattaaatttaagatatcctgtaacatataaatcagaagatcttatggaaaagttc
aataaaaagatagatggaacaggaataaaagtagaaaattttgaggatcaaaaaccttta
tattttgatgcagaacaccaattaataaaatcattacaaaaggtatataaagaacaaaca
ggaaaagaaccagaattactagctataggtggaggaacttatgcaaaagaaatgcctaat
atggttgcctttggaccacttttccctggagaaccagatgtaattcataaaaaagatgaa
tatatagaactagaaaacttggtgttaaatgccaaaatatacgggcatgctatatatgaa
ttagccaaatag

DBGET integrated database retrieval system