KEGG   Clostridium botulinum Ba4: CLJ_0115Help
Entry
CLJ_0115          CDS       T00895                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00230  Purine metabolism
cbi01100  Metabolic pathways
Module
cbi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLJ_0115
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLJ_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 CoaE RsgA_GTPase ABC_tran AAA_28 AAA_22 Zeta_toxin Guanylate_kin AAA_15 AAA_29 AAA_5 G-alpha RNA_helicase APS_kinase AAA_16 AAA_24 MMR_HSR1 Sigma54_activat AAA_17 AAA_23 Cytidylate_kin Viral_helicase1 dNK
Motif
Other DBs
NCBI-ProteinID: ACQ51249
Position
pCLJ:complement(108661..109254)
Genome map
AA seq 197 aa AA seqDB search
MQDNNTDIIICLVGESGSGKSTIAELLEKEGYNYIKSYTTRKPRYKGERGHIFLNSINDR
NDIDILDDGYYLKENVIAYACYKDEHYYATKEQYRNKGTSIYIVEVKGVNELRSEIDDVE
ILVLYLKADEKIRRGRMIKRYIDVNGHSDSNYLMAQREAQERIIHDKEKFQIIPCDYVID
ANMQISEVLKSIKTIIE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataacaatacagatataattatttgtttagtaggggaatctgggtccggtaaa
tctactatagcagaattattggagaaggaaggatataattatataaaaagctatacaact
aggaagccacgatataagggtgagagaggacacatatttttgaatagtataaatgatagg
aatgatattgatatattagatgatggttattatcttaaagaaaatgtaatagcttatgct
tgctataaagatgagcattactatgctactaaagaacaatatagaaataagggaacatcc
atatatatagtagaagttaagggagtcaatgaattaagatcagaaatagatgatgtagaa
atattagtattatatttaaaagcagatgagaaaattagaagaggtagaatgataaaaaga
tatattgatgtaaatggtcatagtgattctaattatttaatggcacaaagagaagcacaa
gaaagaataatacatgataaagaaaagtttcaaataataccttgtgattatgtaatagat
gctaatatgcaaataagtgaagtattaaaaagtataaaaacaataatagaataa

DBGET integrated database retrieval system