KEGG   Clostridium botulinum Ba4: CLJ_B0038Help
Entry
CLJ_B0038         CDS       T00895                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cbi  Clostridium botulinum Ba4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLJ_B0038 (recR)
DNA repair and recombination proteins [BR:cbi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CLJ_B0038 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34149..34745
Genome map
AA seq 198 aa AA seqDB search
MDFYPIAIEKLIEEFAKLPGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSV
CGNFTDKDPCAICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPMAGRGP
EDIKLKELIRRIDGSVNEVIVATNPNVEGEATAMYISKILKPLGVKVTRIAHGVPVGGDL
EYADEVTLAKALEGRIEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggatttttatcctatagctatagaaaaattaatagaagagttcgctaaattaccgggt
ataggttataaaacagctcaaagacttactctatatgtactaaatttacctaaagaagag
gtaaaggaattctcagaggctttagtaaaagctagaggtacaattaaatattgttctgta
tgtggtaattttacagataaagatccttgtgctatatgtagtaatcctaataggaataaa
tctattatttgtgtaatagaacaacctaaagatataatgtctatggaaaaaataagagaa
tataatggagtatatcatgtattacatgggaatatatctcctatggcaggaagaggtcct
gaagacataaaattaaaagaattaataagaagaatagatggtagtgtaaatgaagttata
gttgctactaatcctaatgtagaaggagaagcaacagctatgtatatatctaaaatatta
aaacctctaggagttaaagttacaagaattgcccacggagtaccagtaggtggggattta
gaatatgcagatgaggttactttagctaaagctttagaaggaagaatagaattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system