KEGG   Clostridium botulinum Ba4: CLJ_B0213Help
Entry
CLJ_B0213         CDS       T00895                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLJ_B0213
Enzymes [BR:cbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLJ_B0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199470..201704
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEICEEIVPNTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILENNIERLTE
IEGIGKKKIEIIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYV
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLISEAMD
ILGVREEEIHENIYNNIAENKLKIEKVKEQSCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEVLNFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSDDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSESKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGILGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQILFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKAINFMVQNDK
IFERYSLLKWRISNVLDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatggatat
gtagtggcaaaaataagaaagaagaaagagcttataaccatagtaggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacagtttggc
aatcaattcaaagtagaaatatgtgaagaaatagtacccaatactgtagctggtatagaa
agatatttatcctcaggaattatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacgttaaatatattagagaataatatagaaagattaacagag
atagagggaataggaaagaaaaagatagaaataatatatgattcctatataaaacaaaat
gaagtacgaaatataatgatgttctttcaaaactacggagttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatgta
cttacagaagaaataagaggaataggtttcaagacagcagataaaatagctagaagctta
ggaatagcctctaattcaccctttagaattcagagtggaataaattatataataaatgga
ttctgtagtttaggaaatacttatatgcctttagagaagcttataagcgaggctatggac
atattaggggtaagagaagaagaaatacatgaaaatatatataataatatagcagaaaat
aaattaaagatagaaaaagtaaaagaacaaagctgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagcttatctttgtcacaatatgataattta
aatataaatatagaagacgaggtattgaattttgaaaaaaataataatataaaatttcat
gattctcaaagagaagctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattattaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaacc
acgggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgatgatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcttccatgatagatataatattaatgaatacactgttaaaggccatagcctta
ggtacaagaataataatagttggggatgtagatcaacttccttcagtaggcccaggaaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
aggcaatctaaagaaagcatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaatctaaaaaa
atagttaatacattattagaactttcaaatagaagattacctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggaattttaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcgaaaaaagaaatg
gaatttaaggattatatatttagagtaggagataaagttatgcaaaccaaaaacaactac
tctttaaagtggaccagagcaagtggcgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaagaaaaagaaacaattcagattttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgaaatagatttagcttat
gctgtgactattcataaaagtcaaggtagcgaattcccagtagtaattatgccagctttt
aaaggtccaccacttttaatgaatagaaatttattatatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaagctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttaaagtggcgtataagtaatgttttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system