KEGG   Clostridium botulinum Ba4: CLJ_B0276Help
Entry
CLJ_B0276         CDS       T00895                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00010  Glycolysis / Gluconeogenesis
cbi00051  Fructose and mannose metabolism
cbi00562  Inositol phosphate metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01130  Biosynthesis of antibiotics
cbi01200  Carbon metabolism
cbi01230  Biosynthesis of amino acids
Module
cbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B0276 (tpiA)
   00051 Fructose and mannose metabolism
    CLJ_B0276 (tpiA)
   00562 Inositol phosphate metabolism
    CLJ_B0276 (tpiA)
Enzymes [BR:cbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLJ_B0276 (tpiA)
Exosome [BR:cbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLJ_B0276 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLJ_B0276 (tpiA)
  Exosomal proteins of melanoma cells
   CLJ_B0276 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACQ51503
Position
267160..267906
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEIKGSNIKV
GAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLERQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFSAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaaaatgaacaaaactgtaaaagaagcagta
gaattagttaaagaattaaaaccacttgttaaagacgcaaaatgtgatgtagttgtatgt
cctacttatgtatgtcttccagcagtattagaagaaattaaaggaagcaatataaaagta
ggagctcaaaatatgcattttgaagaaagtggagcttacacaggtgaaatatcacctaaa
atgttagaagaactaggagttcattatgtaattatagggcatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaacaaaaaagtaaaaaaagcctttgaacataactta
attccaatagtttgctgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaagacaaataaaagttggattaaaggaattaagtaaggaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgag
caagcaaatgaaactataggatatataagaaccgtagtaaaagctatgtatggtgaagat
gttgcaagtaaagtaagaatccaatatggtggttctgttaaacctggtactatcaaagct
caaatggctaaagaagaaattgatggtgctctagtaggtggcgcaagtttaaaagcagaa
gatttttcagctatagtaaatttttaa

DBGET integrated database retrieval system