KEGG   Clostridium botulinum Ba4: CLJ_B0276Help
Entry
CLJ_B0276         CDS       T00895                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJ_B0276 (tpiA)
   01230 Biosynthesis of amino acids
    CLJ_B0276 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B0276 (tpiA)
   00051 Fructose and mannose metabolism
    CLJ_B0276 (tpiA)
   00562 Inositol phosphate metabolism
    CLJ_B0276 (tpiA)
Enzymes [BR:cbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLJ_B0276 (tpiA)
Exosome [BR:cbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLJ_B0276 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLJ_B0276 (tpiA)
  Exosomal proteins of melanoma cells
   CLJ_B0276 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267160..267906
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEIKGSNIKV
GAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLERQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFSAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaaaatgaacaaaactgtaaaagaagcagta
gaattagttaaagaattaaaaccacttgttaaagacgcaaaatgtgatgtagttgtatgt
cctacttatgtatgtcttccagcagtattagaagaaattaaaggaagcaatataaaagta
ggagctcaaaatatgcattttgaagaaagtggagcttacacaggtgaaatatcacctaaa
atgttagaagaactaggagttcattatgtaattatagggcatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaacaaaaaagtaaaaaaagcctttgaacataactta
attccaatagtttgctgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaagacaaataaaagttggattaaaggaattaagtaaggaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgag
caagcaaatgaaactataggatatataagaaccgtagtaaaagctatgtatggtgaagat
gttgcaagtaaagtaagaatccaatatggtggttctgttaaacctggtactatcaaagct
caaatggctaaagaagaaattgatggtgctctagtaggtggcgcaagtttaaaagcagaa
gatttttcagctatagtaaatttttaa

DBGET integrated database retrieval system