KEGG   Clostridium botulinum Ba4: CLJ_B0401Help
Entry
CLJ_B0401         CDS       T00895                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CLJ_B0401 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B0401 (adhE)
   00620 Pyruvate metabolism
    CLJ_B0401 (adhE)
   00650 Butanoate metabolism
    CLJ_B0401 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CLJ_B0401 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLJ_B0401 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLJ_B0401 (adhE)
   00626 Naphthalene degradation
    CLJ_B0401 (adhE)
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLJ_B0401 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLJ_B0401 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396986..399574
Genome map
AA seq 862 aa AA seqDB search
MKITTTEELIRKIEKIKEAQKIYSTYSQDKVDKIFKAAATAANKERIKLAKMAVEETGMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVIEKDEAFGLTKIAEPIGVIAAIVPTTNPTSTA
IFKALIALKTRNGIIFSPHPRAKKSTIMAAKIVLDAAVQAGAPKEIIGWIDEPTLELSNA
VMSNSNLVLATGGPGMVKAAYSSGKPAIGVGPGNVPAIIHETADIKMAVSSVVLSKTFDN
GMICASEQSVIVMNSIYEEVKKEFVIRGAYVLNKEEIEKVKKIILVNGNVNAKIVGQTPQ
KIGEMAGIQVPDWAKLLVGEVQSVELEEPFSHEKLSPVLAMYKVKTYEEALAKAERLVEL
GGFGHTSSLYINTIKCKEEVEKFSNNMKTGRTIINMPSAQGGIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLLNIKNVAERRENMLWFRVPEKVYFKYGCLPIALKELKRMNKKKA
FIVTDKVLYELGVAKKATDVLDEIGINYKVFFDVAPDPTLETAKKGAKEMVDFNPDTIIA
IGGGSAMDAAKIMWVMYEHPEVEFEDLAMRFMDIRKRVYEFPHMGDKAMMISVATSAGTG
SEVTPFAVITDEKTGMKYPLADYELTPDMAIVDADLMLNMPKGLTAASGIDALTHAVEAY
VSVMASEYTDGLCLEAIKTIFEYLPKAYKEGAQDIEAREKMAHASTIAGMAFANAFLGVC
HSMAHKLGSMHHVPHGIANALLINETIKFNSEDMPRKQTAFPQYKYPNAKAKYANIADYL
SLGGKTLEEKVELLIKAIDKLKAEVNIPTSIEEAGVSKDKFFTTLDEMSEQAFDDQCTGA
NPRYPLISEIKEMYTNVFSNRK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccactactgaggaactaataagaaaaattgaaaaaatcaaagaggcacaa
aagatttattccacatattctcaagataaagtagataaaatatttaaagcagcagctaca
gcagctaataaagaaagaataaaacttgcaaaaatggcagtagaagagactggcatgggt
attgtagaagataaagttataaaaaatcattttgcatctgaatatatttataacaaatac
aaagatgaaaaaacctgtggtgtaatagaaaaagatgaagcctttgggttaacaaaaatt
gcagaaccaataggtgttattgcggcaatagttccaacaactaatccaacttcaacagct
atttttaaagctttaatagctttaaaaactagaaatggtataattttttcacctcatcca
agagctaaaaagtctacaataatggcagctaagattgttttagatgcagcagtacaagca
ggggcaccaaaagaaataataggttggatagatgaacctaccttagaattgtctaatgca
gtaatgagtaattcaaatctagttcttgcaacaggtggaccaggtatggttaaagcggca
tactcttcaggaaagccagctataggagtaggacctggaaatgtaccagctataatacac
gaaacagcagatattaaaatggctgtaagctcagtggtactttctaaaacttttgataat
ggtatgatttgtgcatcagaacaatcagtaattgtaatgaatagcatatatgaagaagta
aaaaaagaatttgtgattaggggagcctatgtattaaataaagaagagatagaaaaagtt
aagaaaataattttagttaatggaaatgtaaatgctaaaattgttggtcaaacaccccaa
aagataggtgaaatggcaggaatacaagttccagattgggctaaacttttagttggagaa
gttcaatctgtagaattagaagaaccattctctcacgaaaaactatcaccagttttagca
atgtataaagttaaaacttatgaagaggctttagctaaagctgaaagattagtagaatta
ggaggatttggacatacatcttcattgtatataaacacaataaaatgcaaagaagaagta
gaaaagttctcaaataatatgaaaacaggaagaacaattataaatatgccatcagcccaa
ggtggtataggtgatatatataactttaaattagcaccatctctaactcttggttgcgga
tcctggggtggaaactcagtatcagagaatgtaggaccaaaacacttattaaatatcaag
aatgtagctgagaggagagagaatatgctttggtttagagtgccagaaaaagtttacttt
aaatatggatgtcttccaatagctctaaaagaactaaaaagaatgaataagaaaaaggca
tttatagttacagataaagtattatatgaattaggagttgctaaaaaagcaacagatgta
ttagatgaaataggaataaattataaggtattctttgatgtagcaccagatccaacttta
gaaacagcaaaaaaaggtgcaaaagaaatggtagattttaatcctgatacaataatagct
ataggtggaggatctgctatggatgctgctaaaataatgtgggtaatgtatgaacatcca
gaagtagaattcgaagatttagctatgagatttatggatataagaaaaagggtatatgag
ttcccacatatgggagataaagcaatgatgatatcagtagctacttcagcaggtactggt
tcagaagtaactccttttgctgttataactgatgaaaaaacagggatgaaatatccacta
gcagattatgaattaactccagatatggctatagtagatgcagatttaatgcttaatatg
ccaaagggattaactgctgcatcaggaattgatgcattaactcatgcagtagaagcttat
gtatcagttatggcatcagagtatacagatggactatgtttagaagctataaaaaccata
tttgaatatctgccaaaagcttataaagaaggagcccaagatatagaagcaagagaaaaa
atggcccatgcgtcaactatagcaggtatggcttttgcaaatgccttcttaggagtatgc
cactctatggctcataaattaggatctatgcatcatgtaccacatggtatagctaatgct
ttattaataaatgaaacaattaaatttaattctgaggatatgccaagaaagcaaactgct
ttcccacaatacaaatatccaaatgctaaggctaaatatgctaatatagcagattattta
tcattaggtggaaaaactctagaagaaaaagttgagctattaataaaagctatagataaa
ttaaaagcagaagtaaatattccaacctctatagaagaggcaggggtatcaaaggataaa
ttctttacaactttagatgaaatgtctgaacaagcttttgatgatcaatgcacaggagct
aacccaagatatccattaataagtgaaataaaagaaatgtatactaatgtttttagtaat
agaaaataa

DBGET integrated database retrieval system