KEGG   Clostridium botulinum Ba4: CLJ_B0872Help
Entry
CLJ_B0872         CDS       T00895                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLJ_B0872 (folK)
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CLJ_B0872 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904196..904651
Genome map
AA seq 151 aa AA seqDB search
MHTAYVAFGSNIGEKENYIRKALEKIEERKMKIIKVSPIYETEPYGVLDQDSFLNGVVKI
ETNLTPEDLIGELLNIEKQLDRVRERRWGPRTIDLDIIFYDNLIINEKDLVIPHKDMENR
EFVLKPLCDIDENFIHPVLKKSVRELYDRLK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagcttatgtggcctttggcagtaatataggtgaaaaggaaaattacataaga
aaggccttagaaaaaatagaagaaagaaaaatgaaaataattaaagtatctcctatatat
gaaacagaaccctatggagttttagatcaagatagttttttaaatggagtagtaaaaata
gaaactaatttaactccagaagatttaataggggagcttttaaacatagaaaaacagtta
gatagagtaagagaaagaagatggggacctagaactatagatttagatattattttttat
gataatttaataataaatgaaaaagacttagttattcctcataaggatatggaaaacaga
gagtttgtattaaaacctttgtgcgatatagatgaaaattttatacatccagttttaaaa
aaatcagtaagagaattgtatgataggctgaagtaa

DBGET integrated database retrieval system