KEGG   Clostridium botulinum Ba4: CLJ_B0972Help
Entry
CLJ_B0972         CDS       T00895                                 

Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLJ_B0972
Enzymes [BR:cbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLJ_B0972
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLJ_B0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
990892..992352
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIRALKKCTAVMYDRLANGELLKYLAPSCEIYYCGKEPGC
HYKSQDEINKMLVKLAKEGHIVGRIKGGDPYVFGRGGEEALDLLEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKESKIAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNTEESLKSYLSKLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIKMRGIMPSIKSKHFVAE
SLFEEMKRHIQRGDKILVPRSKDARPFLVDALKEEGCIVDEVHIYETLCGKCTHTERFEN
ADTVLFTSPSTVKNMISMVGIDSIKEKNIIAIGPITAAELDKNNIECSSCDEYSINGIID
KLLDLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtatatttaattggtgcagggccaggggatgaagaattaataactttaaaa
gctataagagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaagttgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagtcaggatgaaataaataaaatgctagttaagttagcaaaagaagggcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttagatcttttagaagaaaatatagaatttgaagttataccaggagtaacttccccagtg
tctgtactaaattatgcaggaattcctataacccatagaggaatatcaagaggatttcat
atttttacagcaatgaccaaggataaattagatatagattggaaatccgtagttaatata
ggaggaactttagtatttttaatggggcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaagcaagatagcagtagttatgaaaggcactacctca
aagcaaaaaaaggttataggtaatttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagaatctccagtaataatagtagtgggggaagtagttagtttttcagataaactaaat
tggtatgaaaaaaagcccttattcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggaattaaaagttcaacttttagatttgggggctgaggttacagaaataaattct
atagaaataaaaaataccgaagagagcttaaagtcttatttaagtaaattaaaagaatat
gattatatagcattaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaatgcaaaatttgcagcgataggaccagctactagt
gaagcaataaaaatgcgaggaataatgccaagtataaaatcaaagcattttgtagcagaa
agtctttttgaagaaatgaaaagacatattcaaagaggagataagatacttgtacctcgc
tcaaaagatgcaaggccctttcttgtagatgcattaaaagaagaaggttgcattgtagat
gaagtacatatatatgaaaccttatgtggaaaatgcacacatactgaaagattcgaaaat
gcagatacagtattattcacaagtccatcaactgttaaaaatatgatttccatggtgggc
atagacagtataaaagaaaaaaatattatagcaataggtcctattacagcagcagaatta
gataaaaataatatagaatgcagtagttgtgatgaatattctataaatggcataatagat
aaacttttagaccttaactag

DBGET integrated database retrieval system