KEGG   Clostridium botulinum Ba4: CLJ_B1181Help
Entry
CLJ_B1181         CDS       T00895                                 

Definition
pncA family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cbi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211683..1212243
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFRIN
GGIWPVHCVANRFGAKLEESFYKELQHKNHSPNNKKILFLKGKNDYIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGVKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcaatacttataatagattgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaatattataaatttattaaatataaataaagat
ttaaaagtattttattctttagattggcatagtgaaaataataaatcttttagaataaat
ggtggtatatggccagtacattgtgtagccaatagatttggtgctaaattagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttta
aaaggaaaaaatgattatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
caaggagttaaatttatttaa

DBGET integrated database retrieval system