KEGG   Clostridium botulinum Ba4: CLJ_B1316Help
Entry
CLJ_B1316         CDS       T00895                                 

Gene name
araD
Definition
L-ribulose-5-phosphate 4-epimerase (EC:5.1.3.4)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1350958..1351605
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEAGKRLQQRFFVASNDGNISAKIDDNTILITPTGVNKGEVTPDQIIKV
DRKGNVIEGHMKVTSEIKMHLVVYNMRTDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNMKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaagattacaaattgtagaggcaggaaaaagactgcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaaattgatgataatactata
ttgattacgcctacaggagttaacaaaggagaagtaactccagatcaaataataaaagta
gatagaaaaggaaatgttatagaaggtcatatgaaggttacatctgaaataaaaatgcat
ttagttgtttataatatgagaacagatgtaaaagctatagttcatgcccatccaccagca
tctacagctttttcagtatcaaaagagaaactagatgatcctgttattcttccggaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtccttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatatgaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system