KEGG   Clostridium botulinum Ba4: CLJ_B1666Help
Entry
CLJ_B1666         CDS       T00895                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1700301..1700891
Genome map
AA seq 196 aa AA seqDB search
MAIDVKAIEEHIKGILIALGDNPEREGLKDTPKRVAKMYEEVFKGMCYTNDEIAEMFNVT
FEEDLCVSDNVGDMVFMKDIEIFSHCEHHLALMYNMKVAIAYIPKGKIIGLSKIARIADM
VGRRLQLQERIGSDIAEILKMITDSEDVAVIIEGEHGCMTTRGIKKTGAKTITTTLRGKF
NTDTIVSNKLMMLYTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgttaaggccattgaagagcacataaaaggaattttgatagcattagga
gataatccagaaagagaaggattaaaggatacaccaaaacgtgtagctaaaatgtatgaa
gaagtatttaagggtatgtgctataccaatgatgaaatcgcagaaatgtttaatgtaact
tttgaagaggatttatgtgtaagcgataatgtaggtgatatggtttttatgaaggatata
gagatatttagtcattgtgaacatcacttagcacttatgtacaatatgaaagtagctata
gcatatatacctaagggaaaaattattggtttaagtaaaatagcaagaatagcagatatg
gtaggacgtagactacagcttcaagagagaattgggagtgatatagcagaaattctaaag
atgataactgactcagaggatgtagctgttattatagaaggtgaacatggctgtatgacc
actagaggaataaaaaagacaggtgctaaaactataacaactacattaagaggaaaattt
aatactgatacaattgtaagcaataaattaatgatgctttatacaaaataa

DBGET integrated database retrieval system