KEGG   Clostridium botulinum Ba4: CLJ_B1711Help
Entry
CLJ_B1711         CDS       T00895                                 

Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJ_B1711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B1711
   00052 Galactose metabolism
    CLJ_B1711
   00500 Starch and sucrose metabolism
    CLJ_B1711
   00520 Amino sugar and nucleotide sugar metabolism
    CLJ_B1711
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLJ_B1711
   00524 Butirosin and neomycin biosynthesis
    CLJ_B1711
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLJ_B1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746733..1747680
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLHKIINTIDNVIEGVR
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNVPTYLDNDANVATLAE
FMFGEGRGTQNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPSCGCGNNG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDSLTAKEVFEEAKKGDKVSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVFDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtaggtgttgatttaggaggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaaccgaagcaagcaaggga
gaacttgatgtattgcataaaataataaatactattgataatgttatagaaggggtaaga
ttagaggaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcctagttcagcctataaag
gataaatataatgttccaacatacctagacaatgatgctaatgtagctactttagctgaa
tttatgtttggtgaaggaagaggtacccagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatataggggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccaagctgtggttgtggtaataatggt
tgtgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaggaagtttgtaaa
aataatggagagacatctttaaaaaaatatgatagtctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataaggtttcaaaggaagtactagaattttgcttatcttattta
ggtataactgtagccaatataataaatacctttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttttgatataataaatagagaagtgaaaaataga
tgctggaaagctattagggataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggagttttaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system