KEGG   Clostridium botulinum Ba4: CLJ_B1747Help
Entry
CLJ_B1747         CDS       T00895                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLJ_B1747 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJ_B1747 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLJ_B1747 (thrC)
Enzymes [BR:cbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLJ_B1747 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1787138..1788619
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKTVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFENPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKVSAKKMNITKDIVILTATSGDTGKAALEGFDSVDGTKIVVFYPKDGVSEIQKMQMVTQ
EGKNTLVVGIEGNFDDAQSGVKEIFNDKDFNGLLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNFMTELKEKGKYEITEK
MKKRLDILYGDFSDEDDTLKAVAKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNSATIIA
STASPFKFPKSINEVLNIGHKNASDFELINLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIENFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggggaaggaaaaactgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaaa
tattttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgagaatcctcttatagcaccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggcattaagcatacttccacacctt
ttaaaagtttcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagatggcacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaatgcagatggttacacaa
gagggaaaaaatactctcgtagtaggcatagagggaaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgataaggattttaatggattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatttcatgacagaacttaaagaaaagggtaaatatgagataacagagaaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctgttgcaaaagtctatgagagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagtgctactataatagca
tccactgcaagtccatttaaatttcctaaaagtataaatgaagtattaaatataggacat
aagaatgcttcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattgaaaattttttagggatatag

DBGET integrated database retrieval system