KEGG   Clostridium botulinum Ba4: CLJ_B1747Help
Entry
CLJ_B1747         CDS       T00895                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00260  Glycine, serine and threonine metabolism
cbi00750  Vitamin B6 metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01230  Biosynthesis of amino acids
Module
cbi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJ_B1747 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLJ_B1747 (thrC)
Enzymes [BR:cbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLJ_B1747 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP MtrB_PioB
Motif
Other DBs
NCBI-ProteinID: ACQ53003
Position
1787138..1788619
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKTVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFENPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKVSAKKMNITKDIVILTATSGDTGKAALEGFDSVDGTKIVVFYPKDGVSEIQKMQMVTQ
EGKNTLVVGIEGNFDDAQSGVKEIFNDKDFNGLLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNFMTELKEKGKYEITEK
MKKRLDILYGDFSDEDDTLKAVAKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNSATIIA
STASPFKFPKSINEVLNIGHKNASDFELINLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIENFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggggaaggaaaaactgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaaa
tattttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgagaatcctcttatagcaccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggcattaagcatacttccacacctt
ttaaaagtttcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagatggcacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaatgcagatggttacacaa
gagggaaaaaatactctcgtagtaggcatagagggaaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgataaggattttaatggattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatttcatgacagaacttaaagaaaagggtaaatatgagataacagagaaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctgttgcaaaagtctatgagagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagtgctactataatagca
tccactgcaagtccatttaaatttcctaaaagtataaatgaagtattaaatataggacat
aagaatgcttcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattgaaaattttttagggatatag

DBGET integrated database retrieval system