KEGG   Clostridium botulinum Ba4: CLJ_B1944Help
Entry
CLJ_B1944         CDS       T00895                                 

Gene name
pfkB_1
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLJ_B1944 (pfkB_1)
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     CLJ_B1944 (pfkB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1917048..1917953
Genome map
AA seq 301 aa AA seqDB search
MIYTITFNPALDYVVKVEDFKTGNLNRTSYEKIYAGGKGINVSIVLNNLDVENIALGYIA
GFTGDEIERRVRSFGCKTDFIRLKNGMSRINVKLKSKEESEINGTGPSINTEDLDELFNK
LDNLKEGDFLILAGSIPKTLPENIYETIMERLKDKNIKFVVDATGELLLKVLKYKPFLIK
PNHHELSELFDVEIKNEEEIIGYSRKLQTMGAENVLISMAGDGAIFISSKGEVIKSSVPK
GVLKNSVGAGDSMVAGFILGYLKNNNLENAFKMGLATGSASAFSEGLATKEKVEETLKQI
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactattacttttaatccagctttagactatgtagttaaggtagaggatttt
aaaacaggtaatttaaatagaacaagctatgaaaagatttatgcaggagggaagggaata
aatgtttccatagtcttaaataatttagatgtagaaaatatagctttaggttatatagct
ggttttacaggggatgaaatagaaagaagagttagatcctttggatgtaaaacggatttt
attagattaaaaaatggaatgtctagaataaatgtaaagctaaaatcaaaggaagaatca
gagattaatggaacaggaccttctataaatactgaggacttagatgaattgtttaataaa
ctagataatctaaaagaaggagattttttgatacttgcgggaagcattcctaaaactctt
ccagagaatatatatgaaactataatggaaagacttaaagataaaaatataaaatttgta
gtggatgccactggagaacttttactaaaggtattaaaatataagccatttttaattaag
cctaatcaccatgagttgtcagaattgtttgatgtagaaattaaaaatgaagaagaaata
ataggttatagtagaaaattacagacgatgggagcagaaaatgttcttatttctatggca
ggagatggagcaatatttatttcatctaaaggagaagtaataaaaagtagtgtacctaaa
ggagttttaaaaaattctgtaggagcaggagattctatggtagcaggttttatattagga
tatttaaaaaataataatctggaaaatgcatttaaaatgggtttagctaccggtagtgct
agtgccttttcggaaggattagctaccaaagaaaaagtagaagagacattaaaacaaata
ttataa

DBGET integrated database retrieval system