KEGG   Clostridium botulinum Ba4: CLJ_B2140Help
Entry
CLJ_B2140         CDS       T00895                                 

Gene name
aor
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cbi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2114742..2116559)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEANHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKVSLEKIKILREDPVAGRGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattatctattgaaaataaacttgtt
atagttactggtcctattactggggctcctatgccaaccagtggtagatatatggtagta
acaaaggctcctttaactggtactattgcaatatcaaattctggtgggaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcaaatcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgaaaataatgaaagagcaaaagtacta
tgtataggacccgcaggagaaaaactatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtagtcaatgaagaggaagcaaaaaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtagaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
cagaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggtacagaatgtggaggcccagaatatgagactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagctatggagttatacgaaaaagga
tatataaaagatgaggatataaaagaggatggattatctttaaagtggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagggaaggctttggagataagatggca
gatggttcctatagattatgtgaatcctacggtgttccagagttttccatgacagttaaa
aagcaagaactaccggcctatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
cacgatttgacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacatgatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttctcatgatacccttcccaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatattatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattgaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system