KEGG   Clostridium botulinum Ba4: CLJ_B2197Help
Entry
CLJ_B2197         CDS       T00895                                 

Gene name
pfkB_2
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cbi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2184958..2185881)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRETQKDLLK
YLSSNLKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYEANIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgctcttcgagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aacgtatcactagttttaaatcattattctatagagagtaaagctcttggattttttgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggaaacccaaaaggatttattaaaa
tacttatcatcaaatttaaaaaaaggtgattatttaataataagtggaagtcttccccaa
agtattcaagaggattactacaatgaaattttagatatatgtatggagaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggcaatatttggtctaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctgacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaagctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttggtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtagtgtaa

DBGET integrated database retrieval system