KEGG   Clostridium botulinum Ba4: CLJ_B2941Help
Entry
CLJ_B2941         CDS       T00895                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbi  Clostridium botulinum Ba4
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLJ_B2941
Enzymes [BR:cbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CLJ_B2941
Peptidases [BR:cbi01002]
 Cysteine Peptidases
  Family C44
   CLJ_B2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2914195..2916198)
Genome map
AA seq 667 aa AA seqDB search
MSILSIYNFNKSNFIKEQCNCKEYKFSEYKLNDINIEFGNDGLCNNNNIIYNEDKTILGF
MIGEIYDLDIEMLKNKGHILETDSDIEYIIHLYEECGEKALENLNGKFIILLIDKKRDVQ
IVLNDRYGLMNFYYYNINGKYMFTNYSQHIVHSLGKKEVDEASIREFFNCGCILDDKTII
KDVKRLEQGTIVKIKNNQAEFRKYFDWSAQATKTKDNYEEALEKLFKLWIDAVKKVMAKH
EKFNISISGGMDSRLIVAAIDYLNLNNKINISYTVGIKGCLDELIAREVAKAANFKYKFY
EINDKQYLKHVEERTKRTLRYPLVKAMYFGLIDKSILKCPCLSGLFMGETFGGDFFNSDI
DKIHSKLYGIDNKQMISKMFRNQKSISLKSESECNLKDGFYYIYKYFINKISLINNTIGD
NYNMYPILLENKFYDYLRSLPLEWTKGRKMQTELSIKYFPKFFSDIPYEKTRLPVVFNLN
KVEIEKYSECCKLISQSIGTKHKNIVIFGAGSFGEKVYTVLKDNFNIIYFCDNDSSKWNT
EFCGILVISPEKLKKLKEHSIIVASTYYKEILAQLDNMNIEDYKFIGFTKNTPPYIDFNL
WLKNKYILKKINNDMKHCEFMGEFICRDKVREFLEKFKEYNYGKDNDFLNIISVMYCLKN
NVFLNNK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtctatattatctatctataattttaataaaagtaattttataaaggagcaatgtaat
tgtaaggaatataaatttagtgaatataagttgaacgatataaatattgagtttggaaat
gatggtttatgtaataacaataatataatttataatgaagataaaacaattttaggtttt
atgattggagaaatttatgatttagatatagaaatgctgaaaaataaaggacatatatta
gaaacggatagtgatattgaatacataatacatctgtatgaagaatgtggagaaaaggct
ttagaaaatcttaatggtaaatttattatattattaatagataaaaaaagagatgttcaa
atagtattaaatgatagatatgggttaatgaatttttattattacaatataaatggtaag
tatatgtttactaattattcacagcatattgtacatagcttgggaaaaaaagaagtagat
gaagctagtataagagaattttttaattgtggatgcattttagacgataaaactataatt
aaagatgttaaaagattagaacaagggactatagttaaaataaaaaataatcaagcagag
tttagaaaatattttgattggagtgcacaggctactaaaaccaaggacaattatgaagaa
gcattagaaaaattatttaaactatggattgatgcagtaaaaaaagtaatggcaaagcat
gaaaagtttaacatttcaatttcaggaggaatggattcaagattaatagtagcagctatt
gattatttgaatttaaataacaaaataaacatatcctatacagtggggataaaaggatgt
ctagatgaactgattgctagagaagtagcaaaagccgctaactttaaatataaattttat
gaaataaatgataaacaatatttaaagcatgtagaggaaagaactaaaaggacattgaga
tatcctttagttaaagcaatgtattttggattaatagataaatcaattttgaaatgtcca
tgcctatcaggactttttatgggagaaactttcggaggagatttttttaacagtgatata
gataaaattcatagtaaactatatggtatagataataaacaaatgataagtaaaatgttt
agaaaccaaaaaagtattagtttaaaatctgaaagtgaatgtaatttaaaagatggattt
tattatatatataaatattttataaataaaatatctcttataaataatactataggtgat
aattataatatgtatccaattcttttagaaaataaattttatgattatttacgatcctta
ccactagaatggactaaagggcgtaaaatgcaaacagagttatcaattaagtattttcct
aaattttttagtgatattccttatgaaaaaactagattaccagttgtatttaatttaaat
aaagtggaaatagaaaaatactctgaatgctgtaaactgataagtcaaagtattggcact
aagcataaaaatatagttatatttggagcaggaagttttggagaaaaggtatatactgta
ttgaaggataattttaacataatctatttttgtgataatgatagttcaaaatggaatact
gagttttgtggaatactagtaatttcaccggaaaaacttaagaaattaaaagagcattca
ataatagtagctagtacatattataaagaaatattagctcagttagataatatgaatata
gaggattataaatttataggatttactaaaaatacacctccttatattgattttaattta
tggttaaaaaataaatatattttaaaaaaaataaacaatgatatgaaacattgtgaattt
atgggggaatttatatgtagagataaagtaagagaatttttagaaaagtttaaagaatat
aattatggaaaagataatgattttcttaatataatttctgtaatgtattgtttgaaaaat
aatgtatttttaaataataaataa

DBGET integrated database retrieval system