KEGG   Clostridium botulinum Ba4: CLJ_B3676Help
Entry
CLJ_B3676         CDS       T00895                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00010  Glycolysis / Gluconeogenesis
cbi00030  Pentose phosphate pathway
cbi00051  Fructose and mannose metabolism
cbi00052  Galactose metabolism
cbi00680  Methane metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01130  Biosynthesis of antibiotics
cbi01200  Carbon metabolism
cbi01230  Biosynthesis of amino acids
cbi03018  RNA degradation
Module
cbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B3676 (pfkA)
   00030 Pentose phosphate pathway
    CLJ_B3676 (pfkA)
   00051 Fructose and mannose metabolism
    CLJ_B3676 (pfkA)
   00052 Galactose metabolism
    CLJ_B3676 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLJ_B3676 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLJ_B3676 (pfkA)
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLJ_B3676 (pfkA)
Protein phosphatases and associated proteins [BR:cbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLJ_B3676 (pfkA)
Messenger RNA biogenesis [BR:cbi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLJ_B3676 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACQ51660
UniProt: C3KV06
Position
complement(3697193..3698152)
Genome map
AA seq 319 aa AA seqDB search
MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDI
IQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLLSKLGINTV
GLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYT
GVAGGAESIIIPEKEYNADKLCKQILQGKLKGKMHNLVLLAEGVGGANELAKYIEEVTGI
ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGKSSRVVGIKNGEIIDMDIDEAL
AVERSFDQELYDIATILSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgctatc
agagcagtagttagaacaggtttagaaaaaggtttaaaagtaatgggaattcaaagagga
tataatggacttataaatggagaaatatttgaaatggatactcatagcgtatctgatata
atacaaagaggcggaactatattaagaacagctcgttgtgaagaatttagaacagagcag
ggaagagaaaaagccgctaaaatattaaaagcctttggtattgatggattagttgtaatt
ggtggagacggttcttttcatggggcccaattattatctaagttaggaataaatactgtt
ggactaccaggtactatagataatgatttagcttatacagattatacaattggctttgat
acatctataaatacagttttagatgctataaacaagcttagagatacatccacttctcat
gaaagagtaagtgtagtagaagttatgggaagaaattgtggagatatagcattatataca
ggagtagctggtggagcagaaagtattataataccagaaaaagagtataatgcagataaa
ttatgcaaacaaatactacaaggaaaattaaaagggaaaatgcataacttagttttatta
gcagaaggtgttggaggagctaatgaactagcaaaatatatagaagaagttacagggata
gaaacaagatctacaatattaggacatatacaaagaggtggaagcccaacttgtatggat
agaatattagcttcaagaatggcttataaggcagtagaattattgattagtggtaaatct
tcaagagtagttggtataaaaaatggagaaataattgatatggatatagatgaagcttta
gcagtagaaagaagttttgaccaagaattatatgatatagcaactattttatccaaataa

DBGET integrated database retrieval system