KEGG   Clostridium botulinum H04402 065: H04402_00127Help
Entry
H04402_00127      CDS       T02076                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H04402_00127
Enzymes [BR:cbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     H04402_00127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
167611..168186
Genome map
AA seq 191 aa AA seqDB search
MYGPKDHGWIEVVAGPMYSGKTEELIRRIRRAEIAKQKVQVFKPEIDNRYSKQDVVSHAG
DKIQSVPVKSSKEILEKLLDDTDVIGIDEAQFFDDFLVEIVSKIANNNRRVICAGLDMDF
KGEPFGPMPKLMAIAEFVDKIQAVCMVCNNPATRTQRLINGKPAKKSDPVVLIGAQESYE
ARCRKCHRVPR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtcccaaagatcatggctggattgaagtagtagcaggccctatgtatagtgga
aaaacggaagaattaataagacgaataagaagagctgaaattgcaaagcaaaaagttcaa
gtttttaaacctgaaatagataacagatatagtaaacaagatgttgtgtctcacgcagga
gataaaattcagtcagtaccagttaaaagtagtaaagaaatattagaaaaacttttagat
gatacagatgtgataggtatagatgaagcacaattttttgatgattttttagttgaaata
gtaagtaaaatagctaataataatagaagggttatttgtgcaggactagatatggatttt
aagggagaaccctttggtccaatgcctaaacttatggctatagcagaatttgtagataaa
atacaagctgtatgtatggtttgtaataatccagctacaagaacccaaagacttataaat
ggaaagccagcaaagaaatctgacccagtagtattaataggggcacaagagtcttatgaa
gctagatgtaggaagtgtcatcgtgttccaagataa

DBGET integrated database retrieval system