KEGG   Clostridium botulinum H04402 065: H04402_00353Help
Entry
H04402_00353      CDS       T02076                                 

Definition
alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H04402_00353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H04402_00353
   00620 Pyruvate metabolism
    H04402_00353
   00650 Butanoate metabolism
    H04402_00353
  Lipid metabolism
   00071 Fatty acid degradation
    H04402_00353
  Amino acid metabolism
   00350 Tyrosine metabolism
    H04402_00353
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H04402_00353
   00626 Naphthalene degradation
    H04402_00353
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H04402_00353
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     H04402_00353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427426..430014
Genome map
AA seq 862 aa AA seqDB search
MKITTTEELIRKIEKIKEAQKIYSTYSQDKVDKIFKAAAIAANKERIKLAKMAVEETGMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVIEKDEAFGLTKIAEPIGVIAAIVPTTNPTSTA
IFKALIALKTRNGIIFSPHPRAKKSTIMAAKIVLDAAVQAGAPKEIIGWIDEPTLELSNA
VMSNSNLVLATGGPGMVKAAYSSGKPAIGVGPGNVPAIIHETADIKMAVSSVVLSKTFDN
GMICASEQSVIVMNSIYEEVKKEFVIRGAYVLNKEEIEKVKKIILVNGNVNAKIVGQIPQ
KIGEMAGIQVPDWAKLLVGEVQSVELEEPFSHEKLSPVLAMYKVKSYEEALAKAERLVEL
GGFGHTSSLYINTIKCKEEVEKFSNNMKTGRTIINMPSAQGGIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLLNIKNVAERRENMLWFRVPEKVYFKYGCLPIALKELKRMNKKKA
FIVTDKVLYELGVAKKATDVLDEIGINYKVFFDVAPDPTLETAKKGAKEMVDFNPDTIIA
IGGGSAMDAAKIMWVMYEHPEVEFEDLAMRFMDIRKRVYEFPHMGDKAMMISVATSAGTG
SEVTPFAVITDEKTGVKYPLADYELTPDMAIVDADLMLNMPKGLTAASGIDALTHAVEAY
VSVMASEYTDGLCLEAIKTIFEYLPKAYKEGAQDIEAREKMAHASTIAGMAFANAFLGVC
HSMAHKLGSMHHVPHGIANALLINETIKFNSEDMPRKQTAFPQYKYPNAKAKYANIADYL
SLGGKTPEEKVELLIKAIDKLKAEVNIPTSIEEAGVSKDKFFKTLDEMSEQAFDDQCTGA
NPRYPLISEIKQMYTNVFSTKK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccactactgaggaactaataagaaaaattgaaaaaatcaaagaggcacaa
aagatttattccacatattctcaagataaggtagacaaaatatttaaagcagcagctata
gcagctaacaaagaaagaataaaacttgcaaaaatggcagtagaagaaactggcatgggt
attgtagaagataaagttataaaaaatcattttgcatctgaatatatttataacaaatat
aaagatgaaaaaacctgtggtgtaatagaaaaggatgaagcctttgggttaacaaaaatt
gcagaaccaataggtgttattgcggcaatagttccaacaactaatccaacctcaacagct
attttcaaagctttaatagctttaaaaactagaaatggtataattttttcacctcatcca
agagctaagaaatctacaataatggcagctaagattgttttagatgcagcagtacaagca
ggggcaccaaaagaaataataggttggatagatgaacctaccttagaattgtctaatgca
gtaatgagtaattcaaatctagttcttgcaacaggtggaccaggtatggttaaagcggca
tactcttcaggaaagccagctataggagtaggacctggaaatgtaccagctataatacac
gaaacagcagatattaaaatggctgtaagctcagtggtactttctaaaacttttgataat
ggtatgatttgtgcatcagaacaatcagtaattgtgatgaatagcatatatgaagaagta
aaaaaagaatttgtaattagaggagcctatgtattaaataaagaagagatagaaaaagtt
aagaaaataattttagttaatggaaatgtaaatgctaaaattgttggtcaaataccacaa
aagataggtgaaatggcaggaatacaagttccagattgggctaaacttttagttggagaa
gttcaatctgtagaattagaagaaccattctctcacgaaaaactatcaccagttttagca
atgtataaagttaaaagttatgaagaggctttagctaaagctgaaagattagtagaatta
ggaggatttggacatacatcttcattgtatataaacacaataaaatgcaaagaagaagta
gaaaagttctcaaataatatgaaaacaggaagaacaattataaatatgccatcagcccaa
ggtggtataggtgatatatataactttaaattagcaccatctctaactcttggttgtgga
tcctggggtggaaactcagtatcagagaatgtaggaccaaaacacttattaaatatcaaa
aatgtagctgagaggagagagaatatgctttggtttagagtaccagaaaaagtttacttt
aaatatggatgtcttccaatagctttaaaagaattaaaaagaatgaacaagaaaaaggca
tttatagttacagataaagtattatatgaattaggagttgctaaaaaagcaacagatgtg
ttagatgaaataggaataaattataaggtattctttgatgtagcgccagacccaacttta
gaaacagcaaaaaaaggtgcaaaagaaatggtagattttaatcctgatacaataatagct
ataggtggaggatctgctatggatgctgctaaaataatgtgggtaatgtatgaacatcca
gaagtagaattcgaagatttagctatgagatttatggatataagaaaaagagtatatgag
ttcccacatatgggagataaagcaatgatgatatcagtagctacttcagcaggtactggt
tcagaagtaactccttttgctgttataactgatgaaaaaacaggtgtgaaatatccacta
gcagattatgaattaactccagatatggctatagtagatgcagatttaatgcttaatatg
ccaaagggattaactgctgcatcaggaattgatgcattaactcatgcagtagaagcctat
gtatcagttatggcatcagagtatacagatggactatgtttagaggctataaaaaccata
tttgaatatctaccaaaagcttataaagaaggagcccaagatatagaagcaagagaaaaa
atggctcatgcatcaactatagcaggtatggcttttgcaaatgccttcttaggagtatgc
cactctatggctcataaattaggatctatgcatcatgtaccacatggtatagctaatgct
ttattaataaatgaaacaattaaatttaattctgaggatatgccaagaaagcaaactgct
ttcccacaatataaatatccaaatgctaaggctaaatatgctaatatagcagattattta
tcattaggtggaaaaactccagaagaaaaagttgagctattaataaaagctatagataaa
ttaaaagcagaagtaaatattccaacctctatagaagaggcaggggtatcaaaggataaa
ttctttaaaactttagatgagatgtccgaacaagcttttgatgatcaatgtacaggagct
aatccaagatacccattaataagtgaaataaaacaaatgtatactaatgtttttagtact
aaaaaatag

DBGET integrated database retrieval system