KEGG   Clostridium botulinum H04402 065: H04402_01270Help
Entry
H04402_01270      CDS       T02076                                 

Definition
O-Glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    H04402_01270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    H04402_01270
Enzymes [BR:cbj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     H04402_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1379240..1380568
Genome map
AA seq 442 aa AA seqDB search
MKFIQYKTTKKDKFLKNEINNTTDERPTLHVSQIENRIIEGFGSCFNELGMKALNHLDKD
ERNKVLDQLFSTKGDCRFNLCRMPIGASDYATEWYSYNENENDFDMEKFSIQKDKRLLIP
YIKEALKRNPNIILTASPWSPPTWMKTQKAYNFGTLRFEEKVLKAYALYFVKFVQAYEEE
GITIHQVHVQNEVVADQKFPSCRWTGDQLTDFIKNYLGPAFEKHNIKSEIWLGTINAPEP
YVEWLEDYTQDFDVYAGLVLRDTKAYKYVKGVGYQWAGKNAIQRSVEAFPEKRFIQTENE
CGNGKNTWIYAEYVFNLFRHYIVNGVNGYMYWNAVLEPKGMSTWGWEQNSMITVNPETKE
VMYNPEFYVMKHFSHFVQKGAKRLTTSGVDSVDTVAFKNPDESIIIVISNKNDDSRIANI
EFTGEIFEVELEGHSFNTIVLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatacagtataaaactactaaaaaagataaattcttaaaaaacgaaattaat
aatactacagatgaaagaccaacattacatgtttcacaaattgaaaataggatcatagag
ggatttggaagttgttttaatgagctggggatgaaagcattaaatcacttagacaaagat
gaaagaaataaagtacttgatcaactattttctactaaaggtgattgtcgttttaatctt
tgtagaatgcctattggagcaagtgattatgcaacagaatggtatagctataacgaaaat
gaaaacgattttgatatggagaaatttagtattcaaaaagataaaagacttcttatacct
tatataaaagaagcattaaaaagaaatcctaatataattctaacagcttctccatggagt
cctccaacttggatgaaaacacagaaggcttacaattttgggactctacgctttgaagag
aaagttttaaaagcatatgctctttattttgttaaatttgtacaagcatatgaggaagaa
ggaataacaattcatcaagttcatgttcagaatgaagttgttgcagatcaaaaatttccg
tcttgtagatggacaggagatcaattaacggattttattaaaaattatttaggaccagcc
tttgaaaagcataatattaagagtgaaatttggttagggacaattaatgcgccagagccc
tatgttgaatggctagaagattatacacaagattttgatgtttatgctggcttagtattg
agagatacaaaagcatataagtatgttaaaggagtaggatatcaatgggcaggaaaaaat
gctattcagcgttcagttgaagcatttccagaaaaaagatttatccaaactgaaaatgag
tgcggtaatggtaaaaatacatggatatatgcagaatatgtttttaatctattcagacat
tatattgtaaatggtgtaaatggatatatgtattggaatgctgttttagaaccaaaagga
atgagtacttggggatgggaacagaattctatgataactgtaaatccagaaactaaagaa
gttatgtataatccagagttctatgtaatgaaacatttttctcattttgttcaaaaaggg
gcaaaaagattaactacttcaggtgtagattctgttgatacagtagcttttaagaatcca
gatgaatctataattattgtaatttcaaataaaaatgatgattctagaattgctaatatt
gaatttacaggtgaaatatttgaagttgaattagaaggacattcatttaacactattgtt
ttagaataa

DBGET integrated database retrieval system