KEGG   Clostridium botulinum H04402 065: H04402_01343Help
Entry
H04402_01343      CDS       T02076                                 

Definition
ribulose-5-phosphate 4-epimerase and related epimerases and aldolases
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    H04402_01343
Enzymes [BR:cbj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     H04402_01343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449235..1449882
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEVGKRLQQRFFVASNDGNISAKLDENTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMREDVKAIVHAHPPASTAFSVSKEKLDDPVILLEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaaggttacaaattgtagaagtaggaaaaagacttcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaacttgatgaaaatactata
ttgattacgcctacaggcgttaacaaaggagaagtaaccccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaagttacatctgaaataaaaatgcat
ttagctgtttataatatgagagaagatgtaaaagctatagttcatgcccatccaccagca
tccacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttctagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system