KEGG   Clostridium botulinum H04402 065: H04402_01623Help
Entry
H04402_01623      CDS       T02076                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H04402_01623
Enzymes [BR:cbj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H04402_01623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1747247..1747837
Genome map
AA seq 196 aa AA seqDB search
MAIDVKAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEMFNVT
FEDNLCINDNENDMVFMKEIEIFSHCEHHLALMYNMKVAIAYIPKKKIIGLSKIARIADM
VGRRLQLQERIGSDIAEILQKITDSEDVAVIIEGEHGCMTTRGIKKPGTKTITTTLRGKF
NTDPIVSNKLMMLYTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgttaaagcaattgaagaacacataagggggattttgatagctttagga
gacaacccagagagagaaggtctaaagaacacaccaaaacgtgtagctaaaatgtatgaa
gaagtattcaaaggtatgtgttatagcaatgatgaaattgcagaaatgtttaatgtaacc
tttgaagataatttatgtataaatgataatgaaaatgacatggtttttatgaaggaaata
gagatatttagtcattgtgaacatcatttagcacttatgtacaatatgaaagtagccata
gcatatatacctaagaaaaaaattattggtttaagcaaaatagcacgaatagcagatatg
gtaggacgtagactacagcttcaagagaggattggaagtgatatagcagaaatacttcag
aagataactgactcagaagatgtagctgttattatagaaggagaacatggctgtatgacc
actagaggaataaagaagccaggtactaaaactataacaactacattaaggggaaagttt
aacacagatcctattgtaagcaataaattaatgatgctttatacgaaataa

DBGET integrated database retrieval system