KEGG   Clostridium botulinum H04402 065: H04402_01630Help
Entry
H04402_01630      CDS       T02076                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H04402_01630
Enzymes [BR:cbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H04402_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1753497..1754408
Genome map
AA seq 303 aa AA seqDB search
MDIAVIGSNMVDLISYIDRMPKEGETLEAPDFKMGFGGKGANQAVTAARLKSDVMMVSKV
GDDLFGQNTIKNFKNNGVNTDFVTVQKNQASGVAPIFVDRESKNSILIIKGANKNLSPTD
IDDASEELKKCSLIILQLEIELETVYYAIDFANKNNISVLLNPAPATKELDFNYVYKCDF
FVLNETELEILTNKSVNTIGEIKEAAHLIGDKGVKNVIVTMGSKGLLWINKDEEHFIKAR
KADAVDTTGAGDGFIGCFAHYYVATKNILLALEKATAYAALSVTRYGTQTSYPTKEEFEE
FLK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttattggttcaaatatggtagatttgataagttatattgatagaatg
cccaaagaaggtgagactttagaagcaccagattttaaaatgggatttgggggtaaggga
gcaaatcaggccgttacagctgcaagattaaaatcagatgttatgatggtaagtaaagtt
ggagatgatttatttggacaaaacactataaaaaattttaaaaacaatggtgtaaataca
gattttgtaactgttcagaaaaatcaagctagtggagttgcacctatttttgttgataga
gaatctaaaaatagtattttaattattaaaggtgccaataaaaatttatctcctacagat
atagatgatgcaagtgaagaattgaaaaagtgttctttaattattttacaattggaaatt
gaattagaaactgtttattatgctatagattttgctaataagaataatatttctgtattg
ttaaatcctgcgcctgctacaaaagaacttgatttcaattatgtttataagtgcgatttt
tttgttctaaatgaaacagaattagagattttaacaaataaatctgtaaatacaatagga
gagataaaagaagctgctcatttaattggggataaaggtgttaaaaatgtaattgttaca
atgggcagtaaaggtttactgtggattaataaagatgaagaacattttataaaagcacgt
aaagctgatgccgtggataccactggtgctggtgatggatttattggatgttttgcacat
tattatgtagccacaaaaaacatattattagctcttgaaaaagcaacagcttatgcagca
cttagtgttacaagatatggtactcaaacttcttatcctacaaaggaggagtttgaagaa
tttttaaaataa

DBGET integrated database retrieval system